CAZyme Information: MGYG000002148_00190

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Eisenbergiella
• CAZyme ID: MGYG000002148_00190
• CAZy Family: GH2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
824	MGYG000002148_1|CGC4	95146.66	4.914

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002148	4597814	MAG	United States	North America

• Gene Location: Start: 214802; End: 217276 Strand: +

Full Sequence      

MKTLFLHENWSMNKAGETETFPAIVPGSVYNDLLFNKKMEDPYYRDNEGKALKIMDDDFE
YRTTFDRPEELDGSEEILLHFDGIDTVADIFLNGALLGHVENMHRTWEFPVKAFLRPQGN
ELKVVLYSPTKFIKEANKKNPILGSTDAMAGFPHLRKAHCMFGWDWGPRLPDAGIWRDVR
LIGFEDARIDSVYVTQKHADGTVKLTLYVEVDRIGEELVRRLGEDHRLDDLACRVTLTDP
DGRESVYEHAEAMAGILVEHPQLWWPNGYGSQPLYEIEVELLKDGQALDSWKRRIGLRTM
EMHIEKDQYGEQFCHKVNGVKIFAMGADYIPEDNILARVTPERTYNLLAQAKAAHFNCIR
VWGGGNYPYDAFWDACDELGLIVWEDFMFACAVYDLTEEFEENITAEFIDNIKRIRHHAS
LGLWCGNNEMEMFVLQGEGWVNKPSQKSDYVKMYEYILPKICKKYDPNTFYWPASPSSGG
AFDAPNDENRGDVHYWDVWHGNKPITEYRKFYFRYVSEFGFQSFPSLKTCETFTEPKDRN
IFSYVMEKHQRNSSANGKIMNYMEQTFLYPTGFDTVLYASQLLQAEAIRYGVEHFRRNRG
RCMGTVIWQLNDCWPVASWSSIDYCGRWKAMHYYAKRFFAPIMISCAEEGILSQDTNPNA
EPYEVKKSIHLNVANETMEQVCVTVKWALRNEKAEILRQGEKELCVDALSAAWLDKEEMT
DADLYHNYVSYDCCRNGERISGGTVLFTAPKQFDFADPQLCVRAEGDELVVSAKAYARSV
EIINEADDMLLSDNYFDMNAGECRVKVLKGKPEGLKVRSVYDIR

Enzyme Prediction     

No EC number prediction in MGYG000002148_00190.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	6	715	4e-106	0.6848404255319149

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	9.84e-101	6	681	15	684	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10150	PRK10150	9.96e-16	8	429	32	417	beta-D-glucuronidase; Provisional
PRK10340	ebgA	1.90e-13	30	467	90	468	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam00703	Glyco_hydro_2	2.35e-11	187	298	1	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
pfam17753	Ig_mannosidase	3.32e-08	757	822	1	78	Ig-fold domain. This Ig-like fold domain is found in mannosidase enzymes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEF82182.1	0.0	6	824	6	816
ADL35923.1	0.0	1	820	1	820
QBE97789.1	0.0	6	824	20	837
QJU13790.1	0.0	6	824	6	823
QQQ93614.1	0.0	6	824	6	823

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6BYE_A	7.77e-156	22	824	34	848	Crystalstructure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri in complex with mannose [Xanthomonas citri pv. citri str. 306],6BYE_B Crystal structure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri in complex with mannose [Xanthomonas citri pv. citri str. 306]
6BYC_A	7.99e-156	22	824	34	848	Crystalstructure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
6BYI_A	5.71e-155	22	824	32	846	Crystalstructure of the acid-base mutant (E477A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306],6BYI_B Crystal structure of the acid-base mutant (E477A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
6BYG_A	5.87e-155	22	824	34	848	Crystalstructure of the nucleophile mutant (E575A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306],6BYG_B Crystal structure of the nucleophile mutant (E575A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
2VJX_A	8.61e-154	2	812	7	819	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A1CGA8	2.05e-116	6	814	9	834	Beta-mannosidase B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=mndB PE=3 SV=1
Q4WAH4	1.54e-115	6	814	9	834	Beta-mannosidase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=mndB PE=3 SV=1
B0YBU9	5.87e-115	6	814	9	834	Beta-mannosidase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=mndB PE=3 SV=1
A1D911	8.21e-115	6	814	9	834	Beta-mannosidase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=mndB PE=3 SV=1
Q0CCA0	3.26e-112	23	649	30	661	Beta-mannosidase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=mndB PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000038	0.000009	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002148_00190.