CAZyme Information: MGYG000002148_00087

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Eisenbergiella
• CAZyme ID: MGYG000002148_00087
• CAZy Family: GH38
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
838	MGYG000002148_1|CGC2	93867.24	5.1303

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002148	4597814	MAG	United States	North America

• Gene Location: Start: 96574; End: 99090 Strand: +

Full Sequence      

MLATLYFIDGYHGGIRGHMPEGSWQDILYALERFPEWKISLEIEPDSWEYLRQHDLRTYR
RLQEFIADPDTAERIEFISGSYAQPFCWAVNGESNIRQLLYGRDMIRHHFPNVVIDTYAV
QEPCFTSSLPQILKRLGYRRMSLKNPTAWGGYMAKMPGEIVRLTGPDGSILPAVPRYECE
ELVGCSATEGAGYDYSSIAAFAEKCVGQGIEAPAGMCLQDLGWSSSPLIQGIDVEYVTWR
EYFERFGNRLKGEVPFSQEDICVALPWGNRILGEMLRNVRKAENSILQTEKLLALAATER
KDGRERLAEKREMLRAAWKMLMQAQHHDGYICATCGEGTGQWGFRSNKLALDACALLDHI
SAASQEIITGKENPDLAKESEIWLRVVNTVGSNRTDQAAVTLGLEPGVHSMQVYDEDGEE
VPSQYQAVRRYADGGIGTAALCFTAQNHGIGYHCYKVVLSGESRIPKAGIARKGIQNIIE
VKTDCLHLVFDLMKGGSLVRFKDLRTGRDYAAGVTGFGSLRGYSINEGTFISTANAQVEC
EILENGPLSCKLQFKGSFSDIRFSNTVIVKNGNARIDFETKLYFSEKTEIGYPYEPREEE
RYLGTKRSSCREDYKIGIQIPLGNEKVRVAKSAPFDVYESALDDTRFDSWETIKHNIING
YLDFYQESSDTGLAVFCDAVNGYSLVDNQFSLTAAFGYHGNFWWGYQPAEGLFSVGFSLM
PHPGGWDEGKVSFEDARLREPLLVQRLAGKPERMKRTLLCSEDLSVETVTIELRKEDCLA
RIFHAGCSEKPLKLQGELSACVAGCTDLDGNAAEGPTDRIGKLEIKTLRCEQRNCVED

Enzyme Prediction     

No EC number prediction in MGYG000002148_00087.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH38	23	171	8.9e-21	0.5278810408921933

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01074	Glyco_hydro_38	3.32e-11	23	141	28	141	Glycosyl hydrolases family 38 N-terminal domain. Glycosyl hydrolases are key enzymes of carbohydrate metabolism.
cd10789	GH38N_AMII_ER_cytosolic	4.99e-11	23	173	28	171	N-terminal catalytic domain of endoplasmic reticulum(ER)/cytosolic class II alpha-mannosidases; glycoside hydrolase family 38 (GH38). The subfamily is represented by Saccharomyces cerevisiae vacuolar alpha-mannosidase Ams1, rat ER/cytosolic alpha-mannosidase Man2C1, and similar proteins. Members in this family share high sequence similarity. None of them have any classical signal sequence or membrane spanning domains, which are typical of sorting or targeting signals. Ams1 functions as a second resident vacuolar hydrolase in S. cerevisiae. It aids in recycling macromolecular components of the cell through hydrolysis of terminal, non-reducing alpha-d-mannose residues. Ams1 utilizes both the cytoplasm to vacuole targeting (Cvt, nutrient-rich conditions) and autophagic (starvation conditions) pathways for biosynthetic delivery to the vacuole. Man2C1is involved in oligosaccharide catabolism in both the ER and cytosol. It can catalyze the cobalt-dependent cleavage of alpha 1,2-, alpha 1,3-, and alpha 1,6-linked mannose residues. Members in this family are retaining glycosyl hydrolases of family GH38 that employs a two-step mechanism involving the formation of a covalent glycosyl-enzyme complex. Two carboxylic acids positioned within the active site act in concert: one as a catalytic nucleophile and the other as a general acid/base catalyst.
smart00872	Alpha-mann_mid	5.45e-07	277	335	14	67	Alpha mannosidase, middle domain. Members of this entry belong to the glycosyl hydrolase family 38, This domain, which is found in the central region adopts a structure consisting of three alpha helices, in an immunoglobulin/albumin-binding domain-like fold. The domain is predominantly found in the enzyme alpha-mannosidase.
pfam07748	Glyco_hydro_38C	5.54e-05	486	693	6	193	Glycosyl hydrolases family 38 C-terminal domain. Glycosyl hydrolases are key enzymes of carbohydrate metabolism.
cd10786	GH38N_AMII_like	2.18e-04	49	175	55	197	N-terminal catalytic domain of class II alpha-mannosidases and similar proteins; glycoside hydrolase family 38 (GH38). Alpha-mannosidases (EC 3.2.1.24) are extensively found in eukaryotes and play important roles in the processing of newly formed N-glycans and in degradation of mature glycoproteins. A deficiency of this enzyme causes the lysosomal storage disease alpha-mannosidosis. Many bacterial and archaeal species also possess putative alpha-mannosidases, but their activity and specificity is largely unknown. Based on different functional characteristics and sequence homology, alpha-mannosidases have been organized into two classes (class I, belonging to glycoside hydrolase family 47, and class II, belonging to glycoside hydrolase family 38). Members of this family corresponds to class II alpha-mannosidases (alphaMII), which contain intermediate Golgi alpha-mannosidases II, acidic lysosomal alpha-mannosidases, animal sperm and epididymal alpha -mannosidases, neutral ER/cytosolic alpha-mannosidases, and some putative prokaryotic alpha-mannosidases. AlphaMII possess a-1,3, a-1,6, and a-1,2 hydrolytic activity, and catalyzes the degradation of N-linked oligosaccharides. The N-terminal catalytic domain of alphaMII adopts a structure consisting of parallel 7-stranded beta/alpha barrel. Members in this family are retaining glycosyl hydrolases of family GH38 that employs a two-step mechanism involving the formation of a covalent glycosyl enzyme complex. Two carboxylic acids positioned within the active site act in concert: one as a catalytic nucleophile and the other as a general acid/base catalyst.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCJ98014.1	0.0	2	828	1	822
AMR34539.1	2.38e-128	4	814	10	806
QUR41760.1	1.34e-127	6	825	23	837
AAO79177.1	3.26e-127	6	825	24	832
QMW86426.1	3.26e-127	6	825	24	832

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000067	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002148_00087.