CAZyme Information: MGYG000002140_02828

Basic Information

• Species: CAG-510 sp900551115
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; CAG-510; CAG-510 sp900551115
• CAZyme ID: MGYG000002140_02828
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
822	MGYG000002140_27|CGC1	95301.44	4.7305

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002140	3321781	MAG	United States	North America

• Gene Location: Start: 21554; End: 24022 Strand: +

Full Sequence      

MEKYSLNGEWKLKVIGDNVYHIPQEYVKTVVPGTVFGTYVENGMMPDPFYGENELLAVKL
SDNDFEYVRTFTVEETQLAFDALLLVFEGIDTLADIYINGQLLDYVFNMHIRHEYDVLKL
VKPGENELRVVLHSPVKYIREENEKVYTGGSLDAMEGYPHLRKAHCMFGWDWGPRLPDAG
IFRPVYLLGVEKARIREVYVTQKHTGDRVVLSFAAKNDLFDLSQNYRVEVLVTAPDGTVY
RQEENRTVVIDNPMLWWPNGYGSQPLYTVTAKLLQEREDGESIVLDVWERRIGLRTMEVN
TEPDEWGQSFAHRVNGLDIFAMGADYIPEDNLFGRINADRTRRLLEDCVAANYNCIRVWG
GGYYPDDYFFDICDELGLLVWQDFMFACSSYELDDAFEANIREEIAQNVRRLRHHACLAL
WCGNNEMETQTLDGCWKPSQKQKCDYIKIFEYIIPEIVKKEDPQTFYWPSSPSSGGNYDN
PWDENRGDTHYWDVWHGSRPFTAYRDYHFRYLSEFGFQSFPCLKTVESFTEAADRNIFSR
VMEMHQRNRAANGKILDYLAQTYLYPKDFDSLLYTSQLLQAEAIRYGVEHFRRYRGRCMG
TVVWQLNDIWPVASWASIDYFGRWKALHYAERKMFAPILLSCEETGELSERVSCVQERRN
PIEISARLHVANETWDTVEGTVVWALRRPDASVILEGQEKVTVKPFSGTWLTKLDFSEYD
ERGCYISYGFVKDGKEISAGTTLFTPPKHFKFEDPRLTWQTEGSCIRIKASAYAKSVEIT
ALDGDVRFSDNYFDMNAGEICVQIVSGEATEFSVRSVYDIAF

Enzyme Prediction     

No EC number prediction in MGYG000002140_02828.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	3	704	8.3e-106	0.6781914893617021

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	4.73e-96	1	641	10	635	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10340	ebgA	2.06e-15	67	426	113	449	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam17786	Mannosidase_ig	1.26e-14	667	749	4	91	Mannosidase Ig/CBM-like domain. This domain corresponds to domain 4 in the structure of Bacteroides thetaiotaomicron beta-mannosidase, BtMan2A. This domain has an Ig-like fold.
pfam17753	Ig_mannosidase	1.06e-10	754	819	1	78	Ig-fold domain. This Ig-like fold domain is found in mannosidase enzymes.
PRK10150	PRK10150	1.49e-10	2	431	11	422	beta-D-glucuronidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCK00272.1	0.0	1	820	1	815
QIB55233.1	0.0	1	820	2	808
QMW76907.1	0.0	1	820	2	808
QBE99964.1	0.0	1	820	2	808
AUS95659.1	0.0	1	820	1	802

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2VJX_A	3.47e-152	24	799	23	810	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]
2JE8_A	3.67e-152	24	799	25	812	Structureof a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JE8_B Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
7OP6_A	3.77e-152	24	799	25	812	ChainA, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP6_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_A Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482]
2WBK_A	9.94e-152	24	799	23	810	Structureof the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482],2WBK_B Structure of the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482]
2VQU_A	4.13e-150	24	799	23	810	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQU_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q2TXB7	8.32e-113	3	638	6	656	Beta-mannosidase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=mndB PE=3 SV=3
B8NW36	1.21e-111	3	638	6	656	Beta-mannosidase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=mndB PE=3 SV=1
Q5B7W2	6.30e-111	3	640	6	658	Beta-mannosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=mndB PE=1 SV=2
A2QYN2	6.44e-111	30	807	31	830	Beta-mannosidase B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=mndB PE=3 SV=1
A1CGA8	4.90e-110	30	701	31	713	Beta-mannosidase B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=mndB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000065	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002140_02828.