CAZyme Information: MGYG000002140_02541

Basic Information

• Species: CAG-510 sp900551115
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; CAG-510; CAG-510 sp900551115
• CAZyme ID: MGYG000002140_02541
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
353	MGYG000002140_21|CGC2	39236.25	6.0749

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002140	3321781	MAG	United States	North America

• Gene Location: Start: 30014; End: 31075 Strand: +

Full Sequence      

MNMTPVIPPIHLYINYSDKEESFPTIGQALASLPAVSSAPQAFPAVSEDYIAPVIFHIAP
GIYKERLVIERPYVTFLGQDAETTVITWNLGACEIMPDGEKRGTFRTASVRINTHDFTAK
NISFVNSAGYGHTVGQALALYADGDRLLFEDCRMISSQDTLFTAPLPPTAAKPGGFTGPG
ETKPRIMGRHLYRRCFLQGDVDFIFGSAVSYFEDCTIYSKKPGDRKPPESPDDEVIYGYV
TAASTPEGTPYGYVFSHCRLVSDCPPHSIYLGRPWREWAKTVYLNCEMGAHIHPLGWNDW
NKPHGHFYYGEYRSTGEGACPEKRAAFSHQLTDKEAALYTVKDVLSGPDNWNP

Enzyme Prediction     

No EC number prediction in MGYG000002140_02541.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	17	346	1.4e-84	0.9756944444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4677	PemB	1.68e-61	35	347	100	404	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
pfam01095	Pectinesterase	4.03e-58	23	347	12	297	Pectinesterase.
PLN02682	PLN02682	1.17e-57	7	336	66	352	pectinesterase family protein
PLN02432	PLN02432	3.21e-55	54	349	41	290	putative pectinesterase
PLN02773	PLN02773	2.75e-52	54	351	35	302	pectinesterase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNM04098.1	1.12e-163	22	353	10	339
ABX41678.1	7.59e-136	20	353	14	339
SET76962.1	1.41e-120	23	353	12	321
ADZ82949.1	3.13e-107	57	353	32	320
QEH68466.1	5.82e-105	57	353	32	320

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3UW0_A	2.82e-32	53	298	60	304	Pectinmethylesterase from Yersinia enterocolitica [Yersinia enterocolitica subsp. enterocolitica 8081]
1GQ8_A	1.68e-30	17	347	13	304	Pectinmethylesterase from Carrot [Daucus carota]
1XG2_A	8.07e-28	55	347	34	300	ChainA, Pectinesterase 1 [Solanum lycopersicum]
5C1E_A	3.27e-22	22	319	18	266	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
5C1C_A	4.50e-22	22	319	18	266	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9FM79	6.09e-44	58	351	114	377	Pectinesterase QRT1 OS=Arabidopsis thaliana OX=3702 GN=QRT1 PE=1 SV=1
Q9LVQ0	6.83e-40	55	339	36	290	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
Q8VYZ3	5.56e-39	6	349	79	379	Probable pectinesterase 53 OS=Arabidopsis thaliana OX=3702 GN=PME53 PE=2 SV=1
O23038	6.89e-38	55	351	120	387	Probable pectinesterase 8 OS=Arabidopsis thaliana OX=3702 GN=PME8 PE=2 SV=2
Q9SIJ9	8.25e-38	58	353	85	334	Putative pectinesterase 11 OS=Arabidopsis thaliana OX=3702 GN=PME11 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002140_02541.