CAZyme Information: MGYG000002140_02419

Basic Information

• Species: CAG-510 sp900551115
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; CAG-510; CAG-510 sp900551115
• CAZyme ID: MGYG000002140_02419
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1047	MGYG000002140_19|CGC1	113941.47	3.9857

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002140	3321781	MAG	United States	North America

• Gene Location: Start: 46878; End: 50021 Strand: +

Full Sequence      

MRRKTKRVLSFAMGVLLFVSMLFVAPKQTAEAAENRTDGSFREKIEFEDANRFEENGMNY
IDSSLFSGYSGSGYLYLVSGWGEVHFSVPQDGEYKITLAANADTYKENWLYLDENGAGAL
YTAGNKWEEYTIICNLSAGSHKFGVSANWGYTALDYVIIEAVNAGGSTPTPTPEVTATPV
PTVKPTPEPTAVPTPTPTSPAVEDGFSVKVEFEDAKCYEENGRNRIASDLFSGYSGSGYL
YLEAGWGEVSFTVPKDGEYRITLVTNADSYKENWLYLDEAGAGTLYTGGNSWEKYTEEYT
LGAGTHKFGVSANWGYTALDYVVVEAVDTGSTETPQPTVQPTEAPKPTTEPTATPEPTVT
PTPTATPEPTEVPGGGESQGNGMYVKEGRLYDGNGNEFIMRGINVAHAWYTGYTETSIEA
VADLGANCVRVVLADGTQWTKTGVSEVENIISWCEKNGLVCILEVHDHTGYDDTARLNTA
VDYWLSMKDLLNAHKDYVIVNVANEWLGTWGNGSTWTGAYQSAIRTMRNAGIENVIMVDA
AGYGQETATCIDNCRSVYAADETGNTMFSIHMYSVAGADADTVKSNIDAMLSKGVSFCIG
EFGDFQNGGDVDEQTIMQYCTEKGIGYAAWSWKGNGGTDITLDLSRDWAGTDLTDWGKYV
FYAEGIGIQATARMAYTLKTYDGPGHEGEVTPPEQPGGSGEVDAPSTEIDTELSAGWFEE
LDGWYVSGEGDDTESEITVPETLSNGGIRLNFDLREEKYPYLCNMVGGLDLSENTSIDLV
VRNNNLYPLQIQPIFKVGGLWEWTEYDKYQEVPAQTTTILSFDLTGCPNLDEVMAVLFRV
QGSGSAFAGTIDFLSVVTDYDFEKDSFGGAVAELNRPKTAAFFTWQYPESSWTNTTEYSC
DENGTLTVGFADITEEDAAGPQTETRPGTGTGLNCSAYGKLVSTITNNSDEDIHITLVMK
TTGDWIWQENAGTVDGVGGERVIAPGETVEVVYELDGAEWKSQASGWSYTGKLQGAEDVR
AIAYKIYAGQGEKVTGTVVISDFEFQF

Enzyme Prediction     

No EC number prediction in MGYG000002140_02419.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	392	637	7.2e-88	0.9802371541501976

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	2.26e-32	391	636	1	272	Cellulase (glycosyl hydrolase family 5).
cd04086	CBM35_mannanase-like	8.44e-12	44	160	2	119	Carbohydrate Binding Module 35 (CBM35); appended to several carbohydrate binding enzymes, including several glycoside hydrolase (GH) family 26 mannanase domains. This family includes carbohydrate binding module 35 (CBM35) domains that are appended to several carbohydrate binding enzymes, including periplasmic component of ABC-type sugar transport system involved in carbohydrate transport and metabolism, and several glycoside hydrolase (GH) domains, including GH26. These CBM6s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. Examples of proteins having CMB35s belonging to this family are mannanase A from Clostridium thermocellum (GH26), Man26B from Paenibacillus sp. BME-14 (GH26), and the multifunctional Cel44C-Man26A from Paenibacillus polymyxa GS01 (which has two GH domains, GH44 and GH26). GH26 mainly includes mannan endo-1,4-beta-mannosidase which hydrolyzes 1,4-beta-D-linkages in mannans, galacto-mannans, glucomannans, and galactoglucomannans, but displays little activity towards other plant cell wall polysaccharides. A few proteins belonging to this family have additional CBM3 domains; these CBM3s are not found in the CBM6-CBM35-CBM36_like superfamily.
cd04086	CBM35_mannanase-like	1.19e-10	208	325	1	119	Carbohydrate Binding Module 35 (CBM35); appended to several carbohydrate binding enzymes, including several glycoside hydrolase (GH) family 26 mannanase domains. This family includes carbohydrate binding module 35 (CBM35) domains that are appended to several carbohydrate binding enzymes, including periplasmic component of ABC-type sugar transport system involved in carbohydrate transport and metabolism, and several glycoside hydrolase (GH) domains, including GH26. These CBM6s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. Examples of proteins having CMB35s belonging to this family are mannanase A from Clostridium thermocellum (GH26), Man26B from Paenibacillus sp. BME-14 (GH26), and the multifunctional Cel44C-Man26A from Paenibacillus polymyxa GS01 (which has two GH domains, GH44 and GH26). GH26 mainly includes mannan endo-1,4-beta-mannosidase which hydrolyzes 1,4-beta-D-linkages in mannans, galacto-mannans, glucomannans, and galactoglucomannans, but displays little activity towards other plant cell wall polysaccharides. A few proteins belonging to this family have additional CBM3 domains; these CBM3s are not found in the CBM6-CBM35-CBM36_like superfamily.
pfam16990	CBM_35	5.94e-04	233	326	20	119	Carbohydrate binding module (family 35). This is a mannan-specific carbohydrate binding domain, previously known as the X4 module. Unlike other carbohydrate binding modules, binding to substrate causes a conformational change.
cd04083	CBM35_Lmo2446-like	0.002	232	324	21	125	Carbohydrate Binding Module 35 (CBM35) domains similar to Lmo2446. This family includes carbohydrate binding module 35 (CBM35) domains that are appended to several carbohydrate binding enzymes. Some CBM35 domains belonging to this family are appended to glycoside hydrolase (GH) family domains, including glycoside hydrolase family 31 (GH31), for example the CBM35 domain of Lmo2446, an uncharacterized protein from Listeria monocytogenes EGD-e. These CBM35s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. GH31 has a wide range of hydrolytic activities such as alpha-glucosidase, alpha-xylosidase, 6-alpha-glucosyltransferase, or alpha-1,4-glucan lyase, cleaving a terminal carbohydrate moiety from a substrate that may be a starch or a glycoprotein. Most characterized GH31 enzymes are alpha-glucosidases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKS47268.1	8.61e-149	382	1047	412	1237
CCO04360.1	7.78e-102	381	685	38	337
BAD99527.1	4.44e-101	381	857	34	487
ADU21877.1	1.56e-99	382	673	39	328
QJU43361.1	4.92e-99	381	666	39	324

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1WKY_A	7.38e-103	381	857	8	461	Crystalstructure of alkaline mannanase from Bacillus sp. strain JAMB-602: catalytic domain and its Carbohydrate Binding Module [Bacillus sp. JAMB-602]
2WHJ_A	2.39e-93	382	686	2	303	Understandinghow diverse mannanases recognise heterogeneous substrates [Salipaludibacillus agaradhaerens]
3JUG_A	4.20e-90	381	673	23	313	Crystalstructure of endo-beta-1,4-mannanase from the alkaliphilic Bacillus sp. N16-5 [Bacillus sp. N16-5]
2WHL_A	8.03e-89	382	673	1	288	Understandinghow diverse mannanases recognise heterogeneous substrates [Salipaludibacillus agaradhaerens]
1BQC_A	1.53e-75	382	675	3	298	Beta-MannanaseFrom Thermomonospora Fusca [Thermobifida fusca],2MAN_A Mannotriose Complex Of Thermomonospora Fusca Beta-Mannanase [Thermobifida fusca],3MAN_A Mannohexaose Complex Of Thermomonospora Fusca Beta-mannanase [Thermobifida fusca]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
G1K3N4	1.31e-92	382	686	2	303	Mannan endo-1,4-beta-mannosidase OS=Salipaludibacillus agaradhaerens OX=76935 PE=1 SV=1
P51529	4.10e-70	382	675	39	332	Mannan endo-1,4-beta-mannosidase OS=Streptomyces lividans OX=1916 GN=manA PE=1 SV=2
B3PF24	9.00e-61	382	675	48	342	Mannan endo-1,4-beta-mannosidase OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=man5A PE=1 SV=1
P22533	1.49e-49	402	671	55	326	Beta-mannanase/endoglucanase A OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=manA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000293	0.999004	0.000197	0.000178	0.000163	0.000147

TMHMM  Annotations     

start	end
7	26