CAZyme Information: MGYG000002140_00885

Basic Information

• Species: CAG-510 sp900551115
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; CAG-510; CAG-510 sp900551115
• CAZyme ID: MGYG000002140_00885
• CAZy Family: GH65
• CAZyme Description: Kojibiose phosphorylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
781	MGYG000002140_4|CGC2	89741.32	4.8512

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002140	3321781	MAG	United States	North America

• Gene Location: Start: 54188; End: 56533 Strand: +

Full Sequence      

MLSFPCNDKYPSRWLIKEDDWRISTQRRIESIFSLGNGYMGVRSAAEESYKEQKRGTFVS
GTFDKFEPQEVTELPNVPDQMNIELYENALPVKLVENSKANSYLLNLYNGTAVRTAQFKT
GDGVELNTIFTRYVSKADLHLFAQKMEITASKDVVISVKCGIDGEITNTGAQHFGSREKM
IYGTDTLQAFYETLQSHILFCLRSSFAWKKNGESMDVNGQLEITSRSVYFNFSLALKAGE
TYSLEKINSIYTSVDKEFENKDFTQIKEESLILHNESAANGFEAGLQESEKEWKKFWDNH
DIRIASKDITDQIAVRYAIFHMAVMTPAHDNRMNIGAKGLSGEGYKGHTFWDTEIFLLPF
WIETEPQVARSLLEYRYLSLEGARSKARENGYLGAMYPWESAWVTDGEATPKWGAADVVT
GKPLPIICGDIEQHITCDVAYGVWYYYQMTGDKDFMEKCGYEIIFDTAIYWQSRWEWVSE
NNRYEILNVIGPDEYSEHVNNNAYTNHMSAWNVRLAISYFKELQEKEPKLFKQLEEKLHL
SDYYPLWVEKVEKLYLPAFNEEGLLPQDDAYLTLPAIDIEKYKTSKTRADIIKDYNMEQI
SQLQVAKQADVLALLYLRNDLGDYTKKKINFDYYEKRCLHDSSLSYAIHSILACDFEENQ
LSLDLFNKAKQIDLNDNPKSSVDGIHAASMGGVWQCVVHGFGGLRYVDEATIRIEPHLPE
IWEELSYCISWHGAEIEVCVDKEKIKVCSSKQLPGLSIVSNGNKFSLEEEIVIPLLHERK
N

Enzyme Prediction     

No EC number prediction in MGYG000002140_00885.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH65	316	707	5.9e-136	0.9919354838709677

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1554	ATH1	0.0	14	768	11	761	Trehalose and maltose hydrolase (possible phosphorylase) [Carbohydrate transport and metabolism].
pfam03632	Glyco_hydro_65m	9.26e-141	316	705	1	381	Glycosyl hydrolase family 65 central catalytic domain. This family of glycosyl hydrolases contains vacuolar acid trehalase and maltose phosphorylase.Maltose phosphorylase (MP) is a dimeric enzyme that catalyzes the conversion of maltose and inorganic phosphate into beta-D-glucose-1-phosphate and glucose. The central domain is the catalytic domain, which binds a phosphate ion that is proximal the the highly conserved Glu. The arrangement of the phosphate and the glutamate is thought to cause nucleophilic attack on the anomeric carbon atom. The catalytic domain also forms the majority of the dimerization interface.
PRK13807	PRK13807	3.79e-124	14	775	10	756	maltose phosphorylase; Provisional
pfam03636	Glyco_hydro_65N	1.53e-46	18	253	2	240	Glycosyl hydrolase family 65, N-terminal domain. This family of glycosyl hydrolases contains vacuolar acid trehalase and maltose phosphorylase.Maltose phosphorylase (MP) is a dimeric enzyme that catalyzes the conversion of maltose and inorganic phosphate into beta-D-glucose-1-phosphate and glucose. This domain is believed to be essential for catalytic activity although its precise function remains unknown.
pfam03633	Glyco_hydro_65C	1.95e-04	716	765	1	49	Glycosyl hydrolase family 65, C-terminal domain. This family of glycosyl hydrolases contains vacuolar acid trehalase and maltose phosphorylase.Maltose phosphorylase (MP) is a dimeric enzyme that catalyzes the conversion of maltose and inorganic phosphate into beta-D-glucose-1-phosphate and glucose. The C-terminal domain forms a two layered jelly roll motif. This domain is situated at the base of the catalytic domain, however its function remains unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CQR54097.1	6.53e-245	12	754	13	757
AXM88146.1	7.66e-239	1	775	1	779
AKS37770.1	1.54e-238	1	775	1	779
QOG31907.1	1.84e-238	16	773	8	773
QDM43891.1	2.24e-237	12	771	13	773

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3WIQ_A	9.27e-144	14	747	8	736	Crystalstructure of kojibiose phosphorylase complexed with kojibiose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_A Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_B Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_C Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_D Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903]
4KTR_A	4.09e-103	31	770	31	755	ChainA, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_B Chain B, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_C Chain C, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_D Chain D, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_E Chain E, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_F Chain F, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_G Chain G, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_H Chain H, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10]
4KTP_A	7.98e-103	31	770	31	755	ChainA, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTP_B Chain B, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10]
1H54_A	1.22e-73	26	753	22	739	ChainA, Maltose Phosphorylase [Levilactobacillus brevis],1H54_B Chain B, Maltose Phosphorylase [Levilactobacillus brevis]
7FE3_A	6.00e-56	18	726	21	663	ChainA, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE3_B Chain B, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE3_C Chain C, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE4_A Chain A, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE4_B Chain B, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE4_C Chain C, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P77154	2.99e-146	16	775	7	737	Kojibiose phosphorylase OS=Escherichia coli (strain K12) OX=83333 GN=ycjT PE=1 SV=1
Q8RBL8	6.18e-143	12	767	14	771	Kojibiose phosphorylase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) OX=273068 GN=kojP PE=3 SV=1
Q8L163	2.30e-136	13	768	18	775	Kojibiose phosphorylase OS=Thermoanaerobacter brockii OX=29323 GN=kojP PE=1 SV=1
Q8L164	3.25e-104	14	745	15	747	Alpha,alpha-trehalose phosphorylase OS=Thermoanaerobacter brockii OX=29323 GN=treP PE=1 SV=1
D6XZ22	6.81e-103	31	770	31	755	1,2-alpha-glucosylglycerol phosphorylase OS=Bacillus selenitireducens (strain ATCC 700615 / DSM 15326 / MLS10) OX=439292 GN=Bsel_2816 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000062	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002140_00885.