CAZyme Information: MGYG000002136_02450

Basic Information

• Species: UC5-1-2E3 sp001304875
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; UC5-1-2E3; UC5-1-2E3 sp001304875
• CAZyme ID: MGYG000002136_02450
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
317	MGYG000002136_27|CGC1	35702.71	8.1228

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002136	3193765	MAG	United States	North America

• Gene Location: Start: 9599; End: 10552 Strand: -

Full Sequence      

MTSANQANDKYTLDVVIPTYRPGPGVRRLFGRLLAQTYPIGKIIVMNTEEQFWRADFLPE
IPAGCTTEFEIHHLAKSEFDHGRTRAEGAGYSQADIVLFMTHDAVPATDHLAERLVRAFD
DENVAAAYARQLPADDCNPIERITREFNYPAESRVKSAKDLGELGIKTYFCSNVCAAYRR
EVFERLGGFIRRTIFNEDMIFAAGAVKAGYSIAYVGDGAVIHSHNYTAVEYLRRNFDLGV
SQADHPEVFSGVPSEGEGVKLVKATAARLKEMGKAQLIPKLVWVSAFKYMGYRLGKAYKR
LPPEWIRRLTMNQAYWT

Enzyme Prediction     

No EC number prediction in MGYG000002136_02450.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	14	186	6.8e-18	0.9882352941176471

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1215	BcsA	4.44e-14	12	215	55	257	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
COG1216	GT2	1.04e-13	15	235	7	239	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
pfam00535	Glycos_transf_2	1.21e-12	14	183	1	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
pfam13641	Glyco_tranf_2_3	6.33e-11	15	236	6	225	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.
cd00761	Glyco_tranf_GTA_type	6.33e-10	15	215	1	156	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBK76837.1	1.06e-126	10	316	26	335
AWY99516.1	1.35e-124	12	316	2	301
QBE96877.1	4.53e-119	9	317	2	305
QMW79879.1	4.53e-119	9	317	2	305
QIB57343.1	4.53e-119	9	317	2	305

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P26403	2.00e-55	13	316	3	302	O antigen biosynthesis rhamnosyltransferase RfbN OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfbN PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000054	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002136_02450.