CAZyme Information: MGYG000002133_00675

Basic Information

• Species: Prevotella sp000436915
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp000436915
• CAZyme ID: MGYG000002133_00675
• CAZy Family: GH16
• CAZyme Description: Keratan-sulfate endo-1,4-beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
265	MGYG000002133_17|CGC1	30393.75	7.8611

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002133	2840923	MAG	United States	North America

• Gene Location: Start: 13091; End: 13888 Strand: +

Full Sequence      

MKRRLLFALLVVATTIAMAGNKKEKVIFQDDFNSSNPVPNPKVWKLCEPFKVAWAQHFEH
VKGYENVKVEDGYLKLKANKADGHYKTGGIKTINGFDKNTRVEVRAKLPKRARGAFPAIW
QMPIGGLSWPKSGEIDLMEWVQDTPMEMYQTVHTHYVNGETGTAGATNPNRDQNFDITQF
HVYGAERTDDAVIFYVDGKETYRYENMHLEKEKLQFPFCDFKFNLILNCSLGGTLNGNKT
WAGEIHDEELPVEMWVDWVKVVKTK

Enzyme Prediction     

No EC number prediction in MGYG000002133_00675.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	29	261	5.7e-46	0.9869565217391304

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd08023	GH16_laminarinase_like	5.06e-64	28	261	1	234	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
cd00413	Glyco_hydrolase_16	9.63e-24	30	262	1	210	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
cd08024	GH16_CCF	7.75e-18	86	263	100	330	Coelomic cytolytic factor, member of glycosyl hydrolase family 16. Subgroup of glucanases of unknown function that are related to beta-GRP (beta-1,3-glucan recognition protein), but contain active site residues. Beta-GRPs are one group of pattern recognition receptors (PRRs), also referred to as biosensor proteins, that complexes with pathogen-associated beta-1,3-glucans and then transduces signals necessary for activation of an appropriate innate immune response. Beta-GRPs are present in insects and lack all catalytic residues. This subgroup contains related proteins that still contain the active site and are widely distributed in eukaryotes. Their structures adopt a jelly roll fold with a deep active site channel harboring the catalytic residues, like those of other glycosyl hydrolase family 16 members.
cd02182	GH16_Strep_laminarinase_like	5.99e-15	25	261	3	257	Streptomyces laminarinase-like, member of glycosyl hydrolase family 16. Proteins similar to Streptomyces sioyaensis beta-1,3-glucanase (laminarinase) present in Actinomycetales as well as Peziomycotina. Laminarinases belong to glycosyl hydrolase family 16 and hydrolyze the glycosidic bond of the 1,3-beta-linked glucan, a major component of fungal and plant cell walls and the structural and storage polysaccharides (laminarin) of marine macro-algae. Members of the GH16 family have a conserved jelly roll fold with an active site channel.
pfam00722	Glyco_hydro_16	2.84e-14	63	218	2	140	Glycosyl hydrolases family 16.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCQ30666.1	8.69e-117	3	262	2	271
QKH85928.1	1.23e-116	3	262	2	271
AUI48374.1	1.23e-116	3	262	2	271
QCQ35098.1	5.00e-116	3	262	2	271
QRP59260.1	2.74e-112	24	262	33	271

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6T2O_AAA	1.07e-113	24	262	35	273	ChainAAA, Glycosyl hydrolase family 16 [Bacteroides caccae ATCC 43185],6T2O_BBB Chain BBB, Glycosyl hydrolase family 16 [Bacteroides caccae ATCC 43185]
6T2P_AAA	3.07e-113	24	262	35	273	ChainAAA, Glycosyl hydrolase family 16 [Bacteroides caccae ATCC 43185],6T2P_BBB Chain BBB, Glycosyl hydrolase family 16 [Bacteroides caccae ATCC 43185],6T2Q_AAA Chain AAA, Glycosyl hydrolase family 16 [Bacteroides caccae ATCC 43185],6T2Q_BBB Chain BBB, Glycosyl hydrolase family 16 [Bacteroides caccae ATCC 43185]
6T2S_AAA	4.31e-113	26	262	2	238	ChainAAA, Glycoside hydrolase family 16 protein [Bacteroides finegoldii DSM 17565],6T2S_BBB Chain BBB, Glycoside hydrolase family 16 protein [Bacteroides finegoldii DSM 17565],6T2S_CCC Chain CCC, Glycoside hydrolase family 16 protein [Bacteroides finegoldii DSM 17565]
6T2R_AAA	2.00e-30	16	260	21	259	ChainAAA, Beta-glycosidase [Bacteroides caccae]
3ILN_A	5.28e-24	25	263	6	248	ChainA, Laminarinase [Rhodothermus marinus],3ILN_B Chain B, Laminarinase [Rhodothermus marinus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9ZG90	7.03e-25	10	263	45	288	Keratan-sulfate endo-1,4-beta-galactosidase OS=Sphingobacterium multivorum OX=28454 PE=1 SV=1
P45798	5.51e-24	1	263	12	283	Beta-glucanase OS=Rhodothermus marinus OX=29549 GN=bglA PE=1 SV=1
C1IE32	1.95e-10	28	260	24	265	Glucan endo-1,3-beta-glucosidase OS=Cryptopygus antarcticus OX=187623 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000356	0.998964	0.000198	0.000169	0.000157	0.000137

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002133_00675.