CAZyme Information: MGYG000002133_00642

Basic Information

• Species: Prevotella sp000436915
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp000436915
• CAZyme ID: MGYG000002133_00642
• CAZy Family: GH127
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
814	MGYG000002133_16|CGC1	90778.98	7.8246

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002133	2840923	MAG	United States	North America

• Gene Location: Start: 17316; End: 19760 Strand: +

Full Sequence      

MVAVTIAFTANAQVKSNGGYPITPVPFTSVKVVENSFWGQRLEASRKVTIPLAFSKCEES
GRYKNFQYAAHPSKDYNVNKLEPFSFDDTDPYKTIEGASYILQTYPDAKLKAYIDSVLDI
IATAQEADGYLYTARTMNPEHPHSWSGKTRWSKEEDLSHELYNLGHMVEGAVAHYQATGS
RKFLDIAIRYADCVVREVGPKAGQACVVPGHQIAEMALCRLYLVTGNTKYLDEAKFFLDY
RGKTSIKQEYSQSHKPVIDQDEAVGHAVRAAYMYAGMADVAALTGDSAYIHAIDNIWNNI
VTKKLYITGGIGSTSHGEAFGKNYELPNMSAYCETCAAIGNVYVNYRQFLLHGESKYYDV
LERSLYNGLISGVSLDGGGFFYPNPLESRGQHQRQPWFGCACCPSNICRFIPSLPGYVYA
VKGRSLYVNLFLSNSSQLKVAGKTVALTQNTGYPYDGDIRINIDKNSAGKFAMKIRIPGW
VKGQVVPTTLYSYSDGKRLGFSITINGKEIGNAKLTEDGYFTIDRKWKKGDVVKVHFDME
ARTVRANNNVEADRGMVEVERGPLVYCAEWPDNKFDIKTVILNQEPKFTLGTMALDNFIP
ADSKAKLHAYKEINMKTLTTDAQCLSFDANGRLATKDVRLTLIPYYAWCHRGSGDMKVWL
PQDMKATTPALPATLASTSKIETSSKMPAIESINDRLVPMNADDRSVPYTHWWPKKASTE
WISYTFNEAAEVKSCTTYWFDDQPWGGCSLPKSWKVYYKTADGSWAPVADADNYPTEKGS
ACTVNFKPVKTTALKLEVELPADKSAGIFEWSVK

Enzyme Prediction     

No EC number prediction in MGYG000002133_00642.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH127	33	567	4.8e-201	0.9942748091603053

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	0.0	29	567	1	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	1.35e-164	24	663	11	588	Uncharacterized conserved protein, DUF1680 family [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS84571.1	0.0	3	814	11	822
ADE82616.1	0.0	2	814	11	811
AGB29922.1	0.0	5	814	7	816
QCD36182.1	0.0	1	814	10	802
QJR57394.1	0.0	12	814	19	801

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6EX6_A	0.0	17	668	2	631	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]
4QJY_A	3.95e-138	33	660	18	645	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	2.22e-133	33	660	18	645	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
3WRE_A	1.03e-105	86	659	73	655	Thecrystal structure of native HypBA1 from Bifidobacterium longum JCM 1217 [Bifidobacterium longum subsp. longum JCM 1217],3WRG_A The complex structure of HypBA1 with L-arabinose [Bifidobacterium longum subsp. longum JCM 1217]
3WKW_A	1.37e-105	86	659	73	655	Crystalstructure of GH127 beta-L-arabinofuranosidase HypBA1 from Bifidobacterium longum ligand free form [Bifidobacterium longum subsp. longum JCM 1217],3WKX_A Crystal structure of GH127 beta-L-arabinofuranosidase HypBA1 from Bifidobacterium longum arabinose complex form [Bifidobacterium longum subsp. longum JCM 1217],7BZL_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7DIF_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7EXV_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7EXW_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
E8MGH8	5.62e-105	86	659	73	655	Non-reducing end beta-L-arabinofuranosidase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=hypBA1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000043	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002133_00642.