CAZyme Information: MGYG000002128_01166

Basic Information

• Species: UBA5905 sp900764115
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; UBA5905; UBA5905 sp900764115
• CAZyme ID: MGYG000002128_01166
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
638		68649.18	7.0061

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002128	1836309	MAG	Mongolia	Asia

• Gene Location: Start: 606; End: 2522 Strand: -

Full Sequence      

MTTYRWTSPRRRLTALWLCVCLLVSSFAGLQLLADTIATGTVHVDDSLRVRTGPGTGYAH
IGSLYNGDVVTILETSADGKWYKITKDNLTGYASAEYITINAHYDTNMDFEAYLTAQGFP
ESYKPALRQLHAQYPKWVFKARHLSMTWAEALVGESPVGRNTILSPEAWKSMEYGAYNFD
TGAYVSFDSGGWCAAAPAVIAYYMDPRNFLDGTYVFQFEELSYSADQTVEGIKAILPAEL
HERASQLLQAAKETGVSAYFLATKIVQEGTVKNGLALGKVPGYEGYYNFFDIGAYAADGK
SAVENGAIYAKNHGWSDPYKCMVDSANMLGNNYIKRGQDTPYFQKFNVTNAASGLYRHQY
MTNVVGAASEGKIRGRTAVRDAGLVFSVPVYREMPAASAAYPPRNGNNNNLLDEIAVSGC
GLTPSFDRYTTEYAAQVGADVDSVTITARPNGSGAKVSGGGTVRLNHGENRIELTVTATS
GVTRSYVLTITREGSDSGQQPTITGRTYAVSNIITKVEPGTTVTELIQGLAVQNGTAAVY
TAAGAAKTAGPVGTGDIVRLYSGTAVTASYPVVIYGDVNGDGKIAPVDVLRIQKHIAGLL
TLSGMQQQAADTNRDGKIQPVDALRVQKYLAGLTKSLQ

Enzyme Prediction     

No EC number prediction in MGYG000002128_01166.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4193	LytD	8.35e-27	161	392	24	245	Beta- N-acetylglucosaminidase [Carbohydrate transport and metabolism].
cd14256	Dockerin_I	3.04e-15	575	631	1	57	Type I dockerin repeat domain. Bacterial cohesin domains bind to a complementary protein domain named dockerin, and this interaction is required for the formation of the cellulosome, a cellulose-degrading complex. The cellulosome consists of scaffoldin, a noncatalytic scaffolding polypeptide, that comprises repeating cohesion modules and a single carbohydrate-binding module (CBM). Specific calcium-dependent interactions between cohesins and dockerins appear to be essential for cellulosome assembly. This subfamily represents type I dockerins, which are responsible for anchoring a variety of enzymatic domains to the complex.
pfam00404	Dockerin_1	1.37e-14	576	630	1	55	Dockerin type I repeat. The dockerin repeat is the binding partner of the cohesin domain pfam00963. The cohesin-dockerin interaction is the crucial interaction for complex formation in the cellulosome. The dockerin repeats, each bearing homology to the EF-hand calcium-binding loop bind calcium.
pfam12733	Cadherin-like	1.23e-12	421	493	5	89	Cadherin-like beta sandwich domain. This domain is found in several bacterial, metazoan and chlorophyte algal proteins. A profile-profile comparison recovered the cadherin domain and a comparison of the predicted structure of this domain with the crystal structure of the cadherin showed a congruent seven stranded secondary structure. The domain is widespread in bacteria and seen in the firmicutes, actinobacteria, certain proteobacteria, bacteroides and chlamydiae with an expansion in Clostridium. In contrast, it is limited in its distribution in eukaryotes suggesting that it was derived through lateral transfer from bacteria. In prokaryotes, this domain is widely fused to other domains such as FNIII (Fibronectin Type III), TIG, SLH (S-layer homology), discoidin, cell-wall-binding repeat domain and alpha-amylase-like glycohydrolases. These associations are suggestive of a carbohydrate-binding function for this cadherin-like domain. In animal proteins it is associated with an ATP-grasp domain.
pfam08239	SH3_3	6.31e-11	46	99	1	54	Bacterial SH3 domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCO04280.1	1.52e-123	46	508	37	531
AEN96074.1	5.63e-114	26	611	110	734
QRV21758.1	1.63e-98	10	602	6	749
ADL03932.1	1.63e-98	10	602	6	749
CBK91761.1	2.03e-98	38	611	150	761

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2KRS_A	4.10e-09	40	100	3	61	SolutionNMR structure of SH3 domain from CPF_0587 (fragment 415-479) from Clostridium perfringens. Northeast Structural Genomics Consortium (NESG) Target CpR74A. [Clostridium perfringens]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.382877	0.610827	0.004683	0.000784	0.000366	0.000464

TMHMM  Annotations     

start	end
13	35