CAZyme Information: MGYG000002124_00743

Basic Information

• Species: CAG-110 sp900763965
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Oscillospiraceae; CAG-110; CAG-110 sp900763965
• CAZyme ID: MGYG000002124_00743
• CAZy Family: GH25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
426	MGYG000002124_28|CGC1	48062.01	4.6744

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002124	2646709	MAG	Mongolia	Asia

• Gene Location: Start: 4618; End: 5898 Strand: +

Full Sequence      

MNKRKRILPVVFLLLAALLLTGCTKRAKETDEITTGIDVARYQGTIDWTRVATSSVDFAM
VRLGYRSYADGSIVEDPNARYNLQEAQKNNIMLGAYFFSSAVNTTEAVEEANWAADILDH
YSINYPIAYDCEGFLEETSRQYDMSVKERTDVALAFLKQIEKRGYEGMFYASKNDMEKFH
RWDMSRIEKHYKVWVAQYPEVGYPTTEKSSYTGPHAMWQHTTKGVVPGITQNVDLDVAYF
GYAEINPPVSDVPPEEAKPDVEAMMTFEQVNELVTAKEETNLRSAPSQGEDSTVLYTLKH
GQEATRIAISSSGWSKLEFEGNIYYAVSNLLTTDFNYTPAPVYEEKTEDDGVTTRFVAVQ
EQVTAKIEANLRTLPSVDHPDCKIVTLLKNGTVVTRTGINEELGWSRLDYNGQTVYCVSS
LLKVVQ

Enzyme Prediction     

No EC number prediction in MGYG000002124_00743.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH25	37	229	1.9e-41	0.9943502824858758

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06414	GH25_LytC-like	3.03e-66	36	239	3	191	The LytC lysozyme of Streptococcus pneumoniae is a bacterial cell wall hydrolase that cleaves the beta1-4-glycosydic bond located between the N-acetylmuramoyl-N-glucosaminyl residues of the cell wall polysaccharide chains. LytC is composed of a C-terminal glycosyl hydrolase family 25 (GH25) domain and an N-terminal choline-binding module (CBM) consisting of eleven homologous repeats that specifically recognizes the choline residues of pneumococcal lipoteichoic and teichoic acids. This domain arrangement is the reverse of the major pneumococcal autolysin, LytA, and the CPL-1-like lytic enzymes of the pneumococcal bacteriophages, in which the CBM (consisting of six repeats) is at the C-terminus. This model represents the C-terminal catalytic domain of the LytC-like enzymes.
cd00599	GH25_muramidase	1.93e-29	36	238	2	186	Endo-N-acetylmuramidases (muramidases) are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. This family of muramidases contains a glycosyl hydrolase family 25 (GH25) catalytic domain and is found in bacteria, fungi, slime molds, round worms, protozoans and bacteriophages. The bacteriophage members are referred to as endolysins which are involved in lysing the host cell at the end of the replication cycle to allow release of mature phage particles. Endolysins are typically modular enzymes consisting of a catalytically active domain that hydrolyzes the peptidoglycan cell wall and a cell wall-binding domain that anchors the protein to the cell wall. Endolysins generally have narrow substrate specificities with either intra-species or intra-genus bacteriolytic activity.
pfam01183	Glyco_hydro_25	2.55e-25	37	229	1	180	Glycosyl hydrolases family 25.
cd06413	GH25_muramidase_1	5.77e-19	36	239	5	190	Uncharacterized bacterial muramidase containing a glycosyl hydrolase family 25 (GH25) catalytic domain. Endo-N-acetylmuramidases are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues.
cd06524	GH25_YegX-like	8.20e-18	36	237	2	191	YegX is an uncharacterized bacterial protein with a glycosyl hydrolase family 25 (GH25) catalytic domain that is similar in sequence to the CH-type (Chalaropsis-type) lysozymes of the GH25 family of endolysins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBK93417.1	4.04e-156	29	424	89	483
ACR77025.1	3.28e-155	29	424	89	483
CBK89713.1	4.64e-155	29	424	89	483
CBK74296.1	7.16e-135	29	426	113	522
CUH92515.1	1.22e-133	25	426	93	489

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8FFY2	6.03e-11	36	237	69	253	Uncharacterized protein YegX OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=yegX PE=3 SV=2
Q8X7H0	2.66e-10	36	237	69	253	Uncharacterized protein YegX OS=Escherichia coli O157:H7 OX=83334 GN=yegX PE=3 SV=2
P76421	3.58e-10	36	237	69	253	Uncharacterized protein YegX OS=Escherichia coli (strain K12) OX=83333 GN=yegX PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000073	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
7	24