CAZyme Information: MGYG000002123_00686

Basic Information

• Species: UMGS1696 sp900763885
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; CAG-272; UMGS1696; UMGS1696 sp900763885
• CAZyme ID: MGYG000002123_00686
• CAZy Family: GH95
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
768	MGYG000002123_23|CGC1	85751.05	5.6143

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002123	2956735	MAG	Mongolia	Asia

• Gene Location: Start: 3071; End: 5377 Strand: +

Full Sequence      

MRYELWYNAPAPTIGDELRVHDGALDPNDGWEKWSLPIGCGWFGANVFGRTTTERIQITE
NSLVTRRFTGEVQRNNGGVANFAELFLDFGHETVTEYRRSLDLSTAIAKTEYIWDGARYT
REVFASYPDRVLVVGITASKPGALSFFFRPEMPFGGRDREDTYRTTEKNTVTFGGIYGEY
RVRFSAAFRLFVTGGHTVTEAGGIRVVGADRAYIVAAFGTNYRLSSHVFTAAAEEKLSGN
PDPYPAVQARLDAASAKSYETLRKRHIADYGALFGRVTLDLGEDMPTDLPTDALLRKVQD
GGEDRYLESLYFQYGRYLLLSSARPGTLPPHLQGIWNRYDAPPWGSGYWHNINIQMNYWP
AFVTAIPETFAAYIDFAKAYRDAAEHSADRYIGALYPDRLSPEKGGNGWAIGTAAWPYTV
EGISTSSHSGPGTGAFTTQLFWDAYAFSEDKALLSDFVYPSLYGMATFLEKTLIRRDGHW
LVEYSASPEQPIVGEGYKWNDYYHTCGCTFDQSMVWECFTETLRAAEILGITDDPFLDVL
REKLPDLDPIQIGADGQIKEFREETHYGEIGEPHHRHISHLVGAYPGTLITKKTPEWLRA
VEKTLDFRGDKSTGWAMAHRLTTWARTGNGRRAYMLYHQLLATGTMPNLWDTHPPFQIDG
NLGGCAGVAEMLLQSPAGAIDILPTLPPQWTRGSFRGLRARGAISVDAAWENGALTEAAV
TPDHDREIRLCGVNWRVALDGTAIPTTVQDGNTVFAAEGGRRYTLRQE

Enzyme Prediction     

EC	3.2.1.63

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH95	27	732	4.8e-206	0.9681440443213296

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam14498	Glyco_hyd_65N_2	1.13e-42	5	223	1	232	Glycosyl hydrolase family 65, N-terminal domain. This domain represents a domain found to the N-terminus of the glycosyl hydrolase 65 family catalytic domain.
cd10387	SH2_SOCS6	0.002	267	318	7	57	Src homology 2 (SH2) domain found in suppressor of cytokine signaling (SOCS) proteins. SH2 domain found in SOCS proteins. SOCS was first recognized as a group of cytokine-inducible SH2 (CIS) domain proteins comprising eight family members in human (CIS and SOCS1-SOCS7). In addition to the SH2 domain, SOCS proteins have a variable N-terminal domain and a conserved SOCS box in the C-terminal domain. SOCS proteins bind to a substrate via their SH2 domain. The prototypical members, CIS and SOCS1-SOCS3, have been shown to regulate growth hormone signaling in vitro and in a classic negative feedback response compete for binding at phosphotyrosine sites in JAK kinase and receptor pathways to displace effector proteins and target bound receptors for proteasomal degradation. Loss of SOCS activity results in excessive cytokine signaling associated with a variety of hematopoietic, autoimmune, and inflammatory diseases and certain cancers. Members (SOCS4-SOCS7) were identified by their conserved SOCS box, an adapter motif of 3 helices that associates substrate binding domains, such as the SOCS SH2 domain, ankryin, and WD40 with ubiquitin ligase components. These show limited cytokine induction. In general SH2 domains are involved in signal transduction. They typically bind pTyr-containing ligands via two surface pockets, a pTyr and hydrophobic binding pocket, allowing proteins with SH2 domains to localize to tyrosine phosphorylated sites.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNL40018.1	2.59e-223	3	720	26	741
QGH69931.1	1.66e-222	5	733	56	795
QDO70897.1	1.14e-221	3	755	26	778
QDO95459.1	1.14e-211	3	713	42	748
QBN17887.1	8.59e-191	9	720	32	754

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2RDY_A	2.52e-116	27	767	10	791	ChainA, BH0842 protein [Halalkalibacterium halodurans C-125],2RDY_B Chain B, BH0842 protein [Halalkalibacterium halodurans C-125]
7KMQ_A	9.31e-109	26	730	47	757	ChainA, Glyco_hyd_65N_2 domain-containing protein [Xanthomonas citri pv. citri str. 306],7KMQ_B Chain B, Glyco_hyd_65N_2 domain-containing protein [Xanthomonas citri pv. citri str. 306]
2EAB_A	1.37e-100	5	768	20	897	Crystalstructure of 1,2-a-L-fucosidase from Bifidobacterium bifidum (apo form) [Bifidobacterium bifidum],2EAB_B Crystal structure of 1,2-a-L-fucosidase from Bifidobacterium bifidum (apo form) [Bifidobacterium bifidum],2EAC_A Crystal structure of 1,2-a-L-fucosidase from Bifidobacterium bifidum in complex with deoxyfuconojirimycin [Bifidobacterium bifidum],2EAC_B Crystal structure of 1,2-a-L-fucosidase from Bifidobacterium bifidum in complex with deoxyfuconojirimycin [Bifidobacterium bifidum]
2EAD_A	3.69e-100	5	768	20	897	ChainA, Alpha-fucosidase [Bifidobacterium bifidum],2EAD_B Chain B, Alpha-fucosidase [Bifidobacterium bifidum]
2EAE_A	1.89e-99	5	768	19	896	ChainA, Alpha-fucosidase [Bifidobacterium bifidum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8L7W8	9.83e-95	27	717	59	799	Alpha-L-fucosidase 2 OS=Arabidopsis thaliana OX=3702 GN=FUC95A PE=1 SV=1
A2R797	2.55e-71	77	718	116	764	Probable alpha-fucosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=afcA PE=3 SV=1
Q5AU81	7.66e-55	8	711	16	776	Alpha-fucosidase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=afcA PE=1 SV=1
Q2USL3	2.93e-49	25	737	55	721	Probable alpha-fucosidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=afcA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000039	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002123_00686.