CAZyme Information: MGYG000002113_01820

Basic Information

• Species: Anaerovibrio sp900548165
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Selenomonadales; Selenomonadaceae; Anaerovibrio; Anaerovibrio sp900548165
• CAZyme ID: MGYG000002113_01820
• CAZy Family: GH9
• CAZyme Description: Endoglucanase D

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
597	MGYG000002113_182|CGC1	66000.12	5.1014

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002113	1986108	MAG	Mongolia	Asia

• Gene Location: Start: 473; End: 2266 Strand: +

Full Sequence      

MGIGKMMLAATIGALLPMGCYAGTALAASDGIHVDQVGYLTNHAKIAMVSLTNAENSFCL
VDAVTGQKVYEGKIGVQNNDAMSGDKVAKADFSDFNQPGRYKLVVGDQESADFAIGDNVY
GVAALQNWRSYTLSRTNTPMEDEVTGLKITSGHAQDKEAQVYFTDKLNKKGDVVDVSGGW
YDAGDYGKYTTTAALAAGELMLAYEASPTKFFQGQLFFPQGVKEEAMPDALSEVKFELEF
LKKMQRKDGSTFHKISGAQWPGFDKSPDTDTQQRYIYSTCTASTAMAGAAMAMAGRIYSD
YDKDFANDCLKRAKAVWKYLAKEKESIYRVDEGQESGSGPYNDTDDATERCWLAAELFRT
TGDKQYENYLMKQQKNTILQKPGFFTWDNTLALAQFSYGMAANANHDFQLQVRQKLVDYA
NDIAKTIKNDGYGCSLKANEYTWASTKNAVTKGDILLMAYQFEAKPEYIDGALNQIHYMF
GRNALNKSFMTGIGENPPEHPHNRIHESTGVYVPGLMVGGPNAVSGGDPDQTKYIEEYKP
APAKCYVDVLMSWSTNEYAIDYNGAGIYALSYFMQPDKSITAKDLKLNRSFPKWSFE

Enzyme Prediction     

No EC number prediction in MGYG000002113_01820.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH9	129	570	4.3e-95	0.9712918660287081

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00759	Glyco_hydro_9	5.44e-65	165	570	37	374	Glycosyl hydrolase family 9.
cd02850	E_set_Cellulase_N	8.95e-28	32	115	2	86	N-terminal Early set domain associated with the catalytic domain of cellulase. E or "early" set domains are associated with the catalytic domain of cellulases at the N-terminal end. Cellulases are O-glycosyl hydrolases (GHs) that hydrolyze beta 1-4 glucosidic bonds in cellulose. They are usually categorized into either exoglucanases, which sequentially release terminal sugar units from the cellulose chain, or endoglucanases, which also attack the chain internally. The N-terminal domain of cellulase may be related to the immunoglobulin and/or fibronectin type III superfamilies. These domains are associated with different types of catalytic domains at either the N-terminal or C-terminal end and may be involved in homodimeric/tetrameric/dodecameric interactions. Members of this family include members of the alpha amylase family, sialidase, galactose oxidase, cellulase, cellulose, hyaluronate lyase, chitobiase, and chitinase, among others.
pfam02927	CelD_N	1.34e-23	32	110	3	83	Cellulase N-terminal ig-like domain.
PLN00119	PLN00119	1.62e-09	174	504	73	413	endoglucanase
PLN02613	PLN02613	9.99e-09	170	504	64	403	endoglucanase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAL82172.1	3.82e-280	20	592	21	593
SNV04832.1	1.11e-265	27	592	29	593
BDA09401.1	1.20e-255	27	589	29	590
QIB59262.1	1.39e-254	27	589	29	590
CBL06693.1	4.01e-251	27	587	29	588

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5U0H_A	9.15e-145	40	575	2	541	Crystalstructure of GH family 9 endoglucanase J30 [Thermobacillus composti KWC4]
5U2O_A	1.59e-142	40	575	2	541	Crystalstructure of Zn-binding triple mutant of GH family 9 endoglucanase J30 [Thermobacillus composti KWC4]
3X17_A	2.11e-116	32	573	18	556	Crystalstructure of metagenome-derived glycoside hydrolase family 9 endoglucanase [uncultured bacterium],3X17_B Crystal structure of metagenome-derived glycoside hydrolase family 9 endoglucanase [uncultured bacterium]
4CJ0_A	2.12e-72	32	574	30	548	ChainA, ENDOGLUCANASE D [Acetivibrio thermocellus],4CJ1_A Chain A, ENDOGLUCANASE D [Acetivibrio thermocellus]
1CLC_A	2.83e-72	32	574	44	562	ChainA, ENDOGLUCANASE CELD; EC: 3.2.1.4 [Acetivibrio thermocellus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0C2S4	1.16e-71	32	574	30	548	Endoglucanase D (Fragment) OS=Acetivibrio thermocellus OX=1515 GN=celD PE=1 SV=1
A3DDN1	1.90e-71	32	574	54	572	Endoglucanase D OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celD PE=1 SV=1
P23658	3.16e-69	34	575	6	547	Cellodextrinase OS=Butyrivibrio fibrisolvens OX=831 GN=ced1 PE=1 SV=1
A3DCH1	3.33e-68	32	577	214	815	Cellulose 1,4-beta-cellobiosidase OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celK PE=3 SV=1
P0C2S1	1.20e-67	32	577	214	815	Cellulose 1,4-beta-cellobiosidase OS=Acetivibrio thermocellus OX=1515 GN=celK PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000243	0.258862	0.740557	0.000131	0.000111	0.000095

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002113_01820.