CAZyme Information: MGYG000002113_00482

Basic Information

• Species: Anaerovibrio sp900548165
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Selenomonadales; Selenomonadaceae; Anaerovibrio; Anaerovibrio sp900548165
• CAZyme ID: MGYG000002113_00482
• CAZy Family: GT41
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
527	MGYG000002113_19|CGC1	60534.95	5.2483

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002113	1986108	MAG	Mongolia	Asia

• Gene Location: Start: 16765; End: 18348 Strand: -

Full Sequence      

MQEQYNKAYELYQAGKYNESLAALQDLLDFLKSAENVLWLRPWLLQCYILRNPDCPVQEM
EVLEGLVDKLAEIDNLSDGDRQLGAEIYSLLGEVCCRLGECSLAVEAFLQSANWEQDKAQ
KLIEYSNAIFTTNYCDNISHKRWHKLYDGYRKLLQNIQPLNAKPKGHQKIRIGYLSGDIR
RHPVAYFLRPLLEYADRERFVIYLYQTNQGQDSLSEKLHGWADCVRMVSGKLHEEIAGCI
AEDEIDILVDLSGHTCDNHLPVLAYRPAPVEISAIGYFNSTGLSIDGFLSDKYCSPSSYN
EDFQEPLLQLPDTHFCYSPDFDYPQISLSSPWQRNGYITFGCFNNFSKVTDELLQVWAQL
LQQCPQSRLILKHKLFDSAEGRQWTVRRLENLALPVERIELRGFSADYLQQYNDVDIALD
TYPYTGGLTTMEALLMGVPVVSRYGSRHGTRFGLSFLSNIGMEMLAAANWQEYVQKALLL
AQNPELLQDLRHQIPQLVKNSPLMDGKSYCQAVEKLYIRLYKKRCLS

Enzyme Prediction     

No EC number prediction in MGYG000002113_00482.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT41	13	524	2.5e-93	0.601418439716312

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3914	Spy	2.76e-86	105	517	183	611	Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones].
pfam13844	Glyco_transf_41	1.59e-17	168	511	79	541	Glycosyl transferase family 41. This family of glycosyltransferases includes O-linked beta-N-acetylglucosamine (O-GlcNAc) transferase, an enzyme which catalyzes the addition of O-GlcNAc to serine and threonine residues. In addition to its function as an O-GlcNAc transferase, human OGT also appears to proteolytically cleave the epigenetic cell-cycle regulator HCF-1.
cd04949	GT4_GtfA-like	1.43e-05	351	447	176	271	accessory Sec system glycosyltransferase GtfA and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases and is named after gtfA in Streptococcus gordonii, where it plays a role in the O-linked glycosylation of GspB, a cell surface glycoprotein involved in platelet binding. In general glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found in bacteria.
pfam13692	Glyco_trans_1_4	2.81e-05	351	442	18	102	Glycosyl transferases group 1.
COG0438	RfaB	4.92e-05	254	524	115	381	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAL84160.1	1.15e-145	5	517	408	913
QNH55417.1	3.38e-134	85	522	124	564
ANR70172.1	6.48e-126	78	523	117	565
AOH48972.1	1.03e-124	85	523	124	565
AKT53743.1	1.31e-119	46	523	82	566

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5DJS_A	7.05e-62	148	525	138	520	Thermobaculumterrenum O-GlcNAc transferase mutant - K341M [Thermobaculum terrenum],5DJS_B Thermobaculum terrenum O-GlcNAc transferase mutant - K341M [Thermobaculum terrenum],5DJS_C Thermobaculum terrenum O-GlcNAc transferase mutant - K341M [Thermobaculum terrenum],5DJS_D Thermobaculum terrenum O-GlcNAc transferase mutant - K341M [Thermobaculum terrenum]
5A01_A	1.68e-22	154	523	212	697	O-GlcNActransferase from Drososphila melanogaster [Drosophila melanogaster],5A01_B O-GlcNAc transferase from Drososphila melanogaster [Drosophila melanogaster],5A01_C O-GlcNAc transferase from Drososphila melanogaster [Drosophila melanogaster]
6Q4M_A	2.16e-20	140	522	191	707	Crystalstructure of the O-GlcNAc transferase Asn648Tyr mutation [Homo sapiens]
6IBO_A	2.16e-20	140	522	191	707	Catalyticdeficiency of O-GlcNAc transferase leads to X-linked intellectual disability [Homo sapiens]
2VSN_A	2.82e-20	157	506	195	547	Structureand topological arrangement of an O-GlcNAc transferase homolog: insight into molecular control of intracellular glycosylation [Xanthomonas campestris pv. campestris str. 8004],2VSN_B Structure and topological arrangement of an O-GlcNAc transferase homolog: insight into molecular control of intracellular glycosylation [Xanthomonas campestris pv. campestris str. 8004]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O82039	8.47e-75	127	525	441	850	Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Petunia hybrida OX=4102 GN=SPY PE=2 SV=1
Q8RVB2	1.42e-71	127	525	441	850	Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Solanum lycopersicum OX=4081 GN=SPY PE=2 SV=1
Q96301	4.08e-70	170	525	483	845	Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Arabidopsis thaliana OX=3702 GN=SPY PE=1 SV=1
O82422	1.48e-69	127	525	427	836	Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Hordeum vulgare OX=4513 GN=SPY PE=2 SV=1
Q6YZI0	2.22e-68	127	525	427	836	Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Oryza sativa subsp. japonica OX=39947 GN=SPY PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000026	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002113_00482.