CAZyme Information: MGYG000002108_00122

Basic Information

• Species: Prevotella sp900290275
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900290275
• CAZyme ID: MGYG000002108_00122
• CAZy Family: GH53
• CAZyme Description: Arabinogalactan endo-beta-1,4-galactanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
367	MGYG000002108_2|CGC2	42064.93	7.234

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002108	2842572	MAG	Mongolia	Asia

• Gene Location: Start: 58818; End: 59921 Strand: +

Full Sequence      

MKFILSFLFLLSFSTTQAQTRLLGGDISLLPTYEKAGTKFIDANGKARPLLDIAKDNKWN
AARVRLFVNPADAPTENKDEGVCQDLDYITPLCKQIKKAGMNLMLDFHYSDTWADPGKQF
TPKAWMKCSPSQLCDSVYEHTANALRHLKKNGCAPDLIQVGNEITFGMLWPTAKTDPFNE
KNWDVLADLLKSGVRACREVCPNARLIIHTEHAGDWDATKNYYMRLRNHNVDYDIIGLSY
YPMWHKDIPNLSRTLDSLAVDFPKKDIMIVETAFYYSHDNDRWAKSMDEHSDLYAITEDG
QAQFTKELVDMLKKHPKVTGLYWWFPEENESGKKVIGSWINRGLFNNHTGKVVKAMKNFA
DYRSNND

Enzyme Prediction     

No EC number prediction in MGYG000002108_00122.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH53	24	358	1.4e-99	0.9883040935672515

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07745	Glyco_hydro_53	7.76e-95	24	359	3	333	Glycosyl hydrolase family 53. This domain belongs to family 53 of the glycosyl hydrolase classification. These enzymes are enzymes are endo-1,4- beta-galactanases (EC:3.2.1.89). The structure of this domain is known and has a TIM barrel fold.
COG3867	GanB	2.29e-78	24	331	42	347	Arabinogalactan endo-1,4-beta-galactosidase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT66820.1	8.12e-157	18	357	21	358
QVJ80245.1	2.41e-106	10	361	14	377
AGB28452.1	7.42e-105	24	356	25	361
ADE83762.1	2.41e-96	10	361	14	370
VEH14955.1	1.11e-95	16	361	42	399

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7OSK_A	5.30e-57	24	359	53	391	ChainA, Arabinogalactan endo-1,4-beta-galactosidase [Ignisphaera aggregans DSM 17230],7OSK_B Chain B, Arabinogalactan endo-1,4-beta-galactosidase [Ignisphaera aggregans DSM 17230]
1HJS_A	9.78e-46	24	326	6	298	Structureof two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJS_B Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJS_C Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJS_D Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_A Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_B Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_C Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_D Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus]
4BF7_A	1.74e-43	4	326	2	315	Emericillanidulans endo-beta-1,4-galactanase [Aspergillus nidulans]
1HJQ_A	2.26e-42	24	326	6	298	Structureof two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Humicola insolens]
1R8L_A	1.91e-40	24	326	27	322	Thestructure of endo-beta-1,4-galactanase from Bacillus licheniformis [Bacillus licheniformis],1R8L_B The structure of endo-beta-1,4-galactanase from Bacillus licheniformis [Bacillus licheniformis],1UR0_A The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],1UR0_B The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],1UR4_A The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],1UR4_B The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],2CCR_A Structure of Beta-1,4-Galactanase [Bacillus licheniformis],2CCR_B Structure of Beta-1,4-Galactanase [Bacillus licheniformis],2J74_A Structure of Beta-1,4-Galactanase [Bacillus licheniformis],2J74_B Structure of Beta-1,4-Galactanase [Bacillus licheniformis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P48843	3.74e-57	22	345	7	333	Uncharacterized protein in bgaB 5'region (Fragment) OS=Niallia circulans OX=1397 PE=3 SV=1
Q4WJ80	1.67e-51	4	326	7	321	Probable arabinogalactan endo-beta-1,4-galactanase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=galA PE=3 SV=2
A1D3T4	4.63e-51	10	326	13	321	Probable arabinogalactan endo-beta-1,4-galactanase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=galA PE=3 SV=1
B0XPR3	1.80e-50	4	326	7	321	Probable arabinogalactan endo-beta-1,4-galactanase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=galA PE=3 SV=2
Q0CTQ7	1.97e-46	4	326	2	314	Probable arabinogalactan endo-beta-1,4-galactanase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=galA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000427	0.998776	0.000219	0.000190	0.000171	0.000165

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002108_00122.