CAZyme Information: MGYG000002085_00984

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Oscillospiraceae; CAG-170
• CAZyme ID: MGYG000002085_00984
• CAZy Family: GH66
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
539	MGYG000002085_66|CGC1	60386.53	4.7536

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002085	2687840	MAG	Mongolia	Asia

• Gene Location: Start: 5189; End: 6808 Strand: +

Full Sequence      

MKLICEFDRAQYLTGQEVRLSLPEGVNAPRVCVYRLETPVDCSVRQSGRTLILPPLPIGS
YGVAVEAGSARWEGAFDVVEDPRQVTRYAFLSDFTSADTETQDVDWLRRLHFNAVQFYDW
MYRHDMLLPPQERYLDPMGRETDLAAIRAKIAACKAAGIRPIAYGAVYAAAKELFAEHPE
WAMYTMDGQAMTFAGWLYYMNIAPSCGWSEHILEEFRKAVAFGFSGIHMDTYGFPKQVWD
AERRPVELTDALPKLIDRAAEAVRKEDSAAGVIFNAVNNWPMEAVAGTKQDAVYIEVWPP
NDRYCDLYTLIREARLCSGKQVVLAAYLHPFQQADTDGAERAFRLSWAAICAAGGTQLVL
GENKAALQDSYYANYASLRAAFLPVVQRYCDFLVRYAALLYLDAGMDIGRTAAGGINEDI
QFEAEDCVFSTDAEADTVWSMIRESGSRLNIQLVNLHGNNARWNEAKAAPKAAENIRIHV
RLDRPIAGAFAASPDGESLCAERLPLTCRQTPQGRIYTAELARLDYWAAVWFTMEEEVC

Enzyme Prediction     

No EC number prediction in MGYG000002085_00984.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH66	70	531	1.8e-97	0.8381294964028777

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13199	Glyco_hydro_66	0.0	7	531	1	557	Glycosyl hydrolase family 66. This family is a set of glycosyl hydrolase enzymes including cycloisomaltooligosaccharide glucanotransferase (EC:2.4.1.-) and dextranase (EC:3.2.1.11) activities.
cd14745	GH66	5.78e-120	87	396	4	331	Glycoside Hydrolase Family 66. Glycoside Hydrolase Family 66 contains proteins characterized as cycloisomaltooligosaccharide glucanotransferase (CITase) and dextranases from a variety of bacteria. CITase cyclizes part of a (1-6)-alpha-D-glucan (dextrans) chain by formation of a (1-6)-alpha-D-glucosidic bond. Dextranases catalyze the endohydrolysis of (1-6)-alpha-D-glucosidic linkages in dextran. Some members contain Carbohydrate Binding Module 35 (CBM35) domains, either C-terminal or inserted in the domain or both.
pfam14871	GHL6	0.007	104	230	6	134	Hypothetical glycosyl hydrolase 6. GHL6 is a family of hypothetical glycoside hydrolases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUH30411.1	1.84e-108	53	531	77	564
AHV97051.1	3.03e-107	9	528	15	564
AUS97991.1	7.97e-107	8	536	15	574
ADV78896.1	5.15e-106	75	535	91	560
ABY93935.1	5.94e-106	75	535	96	565

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3WNK_A	2.53e-28	8	531	33	720	ChainA, Cycloisomaltooligosaccharide glucanotransferase [Niallia circulans]
3WNL_A	2.51e-27	8	531	14	701	ChainA, Cycloisomaltooligosaccharide glucanotransferase [Niallia circulans],3WNM_A Chain A, Cycloisomaltooligosaccharide glucanotransferase [Niallia circulans],3WNN_A Chain A, Cycloisomaltooligosaccharide glucanotransferase [Niallia circulans],3WNN_B Chain B, Cycloisomaltooligosaccharide glucanotransferase [Niallia circulans],3WNO_A Chain A, Cycloisomaltooligosaccharide glucanotransferase [Niallia circulans],3WNO_B Chain B, Cycloisomaltooligosaccharide glucanotransferase [Niallia circulans]
3WNP_A	2.51e-27	8	531	14	701	ChainA, Cycloisomaltooligosaccharide glucanotransferase [Niallia circulans],3WNP_B Chain B, Cycloisomaltooligosaccharide glucanotransferase [Niallia circulans]
5AXG_A	1.98e-26	75	527	139	603	Crystalstructure of thermophilic dextranase from Thermoanaerobacter pseudethanolicus [Thermoanaerobacter pseudethanolicus ATCC 33223],5AXG_B Crystal structure of thermophilic dextranase from Thermoanaerobacter pseudethanolicus [Thermoanaerobacter pseudethanolicus ATCC 33223]
5AXH_A	1.51e-25	75	527	139	603	Crystalstructure of thermophilic dextranase from Thermoanaerobacter pseudethanolicus, D312G mutant in complex with isomaltohexaose [Thermoanaerobacter pseudethanolicus ATCC 33223],5AXH_B Crystal structure of thermophilic dextranase from Thermoanaerobacter pseudethanolicus, D312G mutant in complex with isomaltohexaose [Thermoanaerobacter pseudethanolicus ATCC 33223]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P70873	7.62e-30	8	531	42	729	Cycloisomaltooligosaccharide glucanotransferase OS=Niallia circulans OX=1397 GN=cit PE=3 SV=1
P94286	5.90e-28	8	531	50	737	Cycloisomaltooligosaccharide glucanotransferase OS=Niallia circulans OX=1397 PE=1 SV=1
Q54443	7.50e-10	184	495	335	681	Dextranase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) OX=210007 GN=dexA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000020	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002085_00984.