CAZyme Information: MGYG000002082_01398

Basic Information

• Species: Alistipes sp900544265
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes; Alistipes sp900544265
• CAZyme ID: MGYG000002082_01398
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
540	MGYG000002082_8|CGC1	60442.68	4.1442

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002082	2573115	MAG	Netherlands	Europe

• Gene Location: Start: 91047; End: 92669 Strand: +

Full Sequence      

MKGNIMKHTGFIRLFRGAAFGCAATLLLVGCTEEPISYGAGQEPDGEALETVSGTLRSRR
SLRDRIPVRLVEGYEDDVADQIYYRLNTTTSQPVTVTVSPDLSLVDTYNDANQTNLQPLP
IENVILGNGGALTVSAGAVFSEPLEVVFSAKNLSPGTYLLPLSLQSDETNPGVLYYGITV
REFDDNLFQQGDNSLEIPLDTEWTTVFYINTSEAQAQYADYVAWEKQDINDFQNVYRASL
GNIIVLRIAQVDYDDAMHRVLFAPTSDLFYTLEHSDKYIAQMKDKGRKICVCIEGAGKGI
GFCNMTDAQIADFVSQVKVFVETYDLDGINLWDRGAGYGKEGMPAMNTTSYPKLIKAMRE
ALGKDRLLTVVDYEEPTEYFYDTSATGGIAVGDYIDYAWHGYVSEDEPVVFCNPYNSNTL
YVQRVQRKPFAGLEEERYGNVNVPFYAANSNLFMDFDGAWIYDLSGWGENPTCNLIVFND
LKLPEAVVTEQGCIDMLDNFFMNLSYDYDGNQLFNSIVVTRIPGIYRNSSKNYDTFAKDW

Enzyme Prediction     

No EC number prediction in MGYG000002082_01398.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06542	GH18_EndoS-like	1.35e-16	269	468	47	231	Endo-beta-N-acetylglucosaminidases are bacterial chitinases that hydrolyze the chitin core of various asparagine (N)-linked glycans and glycoproteins. The endo-beta-N-acetylglucosaminidases have a glycosyl hydrolase family 18 (GH18) catalytic domain. Some members also have an additional C-terminal glycosyl hydrolase family 20 (GH20) domain while others have an N-terminal domain of unknown function (pfam08522). Members of this family include endo-beta-N-acetylglucosaminidase S (EndoS) from Streptococcus pyogenes, EndoF1, EndoF2, EndoF3, and EndoH from Flavobacterium meningosepticum, and EndoE from Enterococcus faecalis. EndoS is a secreted endoglycosidase from Streptococcus pyogenes that specifically hydrolyzes the glycan on human IgG between two core N-acetylglucosamine residues. EndoE is a secreted endoglycosidase, encoded by the ndoE gene in Enterococcus faecalis, that hydrolyzes the glycan on human RNase B.
pfam08522	DUF1735	3.80e-12	71	171	20	120	Domain of unknown function (DUF1735). This domain of unknown function is found in a number of bacterial proteins including acylhydrolases. The structure of this domain has a beta-sandwich fold.
cd00598	GH18_chitinase-like	2.09e-06	221	397	5	170	The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods. Chitinases have been identified in viruses, bacteria, fungi, protozoan parasites, insects, and plants. The structure of the GH18 domain is an eight-stranded beta/alpha barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel. The GH18 family includes chitotriosidase, chitobiase, hevamine, zymocin-alpha, narbonin, SI-CLP (stabilin-1 interacting chitinase-like protein), IDGF (imaginal disc growth factor), CFLE (cortical fragment-lytic enzyme) spore hydrolase, the type III and type V plant chitinases, the endo-beta-N-acetylglucosaminidases, and the chitolectins. The GH85 (glycosyl hydrolase, family 85) ENGases (endo-beta-N-acetylglucosaminidases) are closely related to the GH18 chitinases and are included in this alignment model.
cd02871	GH18_chitinase_D-like	3.45e-04	242	403	29	175	GH18 domain of Chitinase D (ChiD). ChiD, a chitinase found in Bacillus circulans, hydrolyzes the 1,4-beta-linkages of N-acetylglucosamine in chitin and chitodextrins. The domain architecture of ChiD includes a catalytic glycosyl hydrolase family 18 (GH18) domain, a chitin-binding domain, and a fibronectin type III domain. The chitin-binding and fibronectin type III domains are located either N-terminal or C-terminal to the catalytic domain. This family includes exochitinase Chi36 from Bacillus cereus.
cd06548	GH18_chitinase	4.68e-04	288	370	86	180	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBL01830.1	2.70e-119	28	540	24	538
ALJ47937.1	2.12e-114	1	513	1	517
SCV07341.1	2.12e-114	1	513	1	517
QRQ54816.1	2.12e-114	1	513	1	517
BBL09700.1	6.94e-112	1	540	1	544

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2EBN_A	1.83e-12	240	402	38	199	CRYSTALSTRUCTURE OF ENDO-BETA-N-ACETYLGLUCOSAMINIDASE F1, AN ALPHA(SLASH)BETA-BARREL ENZYME ADAPTED FOR A COMPLEX SUBSTRATE [Elizabethkingia meningoseptica]
1C8X_A	3.36e-12	222	402	7	190	ChainA, ENDO-BETA-N-ACETYLGLUCOSAMINIDASE H [Streptomyces plicatus]
1C8Y_A	3.36e-12	222	402	7	190	ChainA, ENDO-BETA-N-ACETYLGLUCOSAMINIDASE H [Streptomyces plicatus]
1C90_A	3.36e-12	222	402	7	190	ChainA, ENDO-BETA-N-ACETYLGLUCOSAMINIDASE H [Streptomyces plicatus],1C90_B Chain B, ENDO-BETA-N-ACETYLGLUCOSAMINIDASE H [Streptomyces plicatus]
1C93_A	3.36e-12	222	402	7	190	ChainA, ENDO-BETA-N-ACETYLGLUCOSAMINIDASE H [Streptomyces plicatus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P36911	1.60e-11	240	402	88	249	Endo-beta-N-acetylglucosaminidase F1 OS=Elizabethkingia meningoseptica OX=238 GN=endOF1 PE=1 SV=1
P04067	4.13e-11	222	402	54	237	Endo-beta-N-acetylglucosaminidase H OS=Streptomyces plicatus OX=1922 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000020	0.001004	0.999000	0.000004	0.000002	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002082_01398.