CAZyme Information: MGYG000002063_00072

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella
• CAZyme ID: MGYG000002063_00072
• CAZy Family: GH106
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1410	MGYG000002063_2|CGC1	158209.64	7.7001

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002063	2224261	MAG	China	Asia

• Gene Location: Start: 27066; End: 31298 Strand: +

Full Sequence      

MIRLKKLLLLMTVAVLADVAVASDRLWQTFLKPQQEARTKLWWFHGETVTTREGIDADLA
AFKAAGIGGVVYYDQTHGTEQGAFPALSQSWWDMLKYAALRAKELGLSFEIAASNGYVTG
GPWVSPEMSMKEIVVLRDGDRVPKGFREITRLTLPQGLDTCIQRSRLTLKDNEPATIVFD
GGKAHEVRSLSLMLTPRGKGSYGSMNVPGKPQELHFGAGYVLMPPIGELECSDDGVTWRT
VTEVRGVEDIIGHKSRQRTQNFKPVKARFFRLNIHDWLGPKSKYTKLEVENVRLMGYDML
DNWEQKSGLRSEVTATLSPRGKHKTGSGGATYCIGYAPTGGHAKHGRSNIVWNGELRTAK
TWLESDVMSAAAAENHYRSYIKPVIDTLTAIGCKPQGVCMDSHEAGVANWTERMPEHFRR
LRGYDLVPWIPALGGVIVESREKTEAFLADYRRTIEELISEQYYGTMARLCHEDGLTLTS
QAMLGCVNDNIASRGMVDKPQGEFWAYQTNGNYDCLDAASAAHLYGKKIASGEAFTDSPY
FTKETTDEAEATAGWHKLLRIANLAYCRGINEFVVCASSYQPWMDRKYDDSRSQHPYIFH
RHNSAWPWSREHFWEYQARCTQLLQTGRPVVDLLVYVGQDAPLKTMAYKLPIMPEGYCFD
VCTMRSLKAWKENRNSTYAPDYKVLVVQDRTWITPEAEALFAEMKSLGLLVVRCDKGEDV
GASLAAAGLKPDMRIESRDEADDKTYFCHRKTDEADIYFVYNHSNHDTENPLELRGEMRG
MELWNPLTGERRKPEDGKLRLRPYESVFVIAKGKDVIDPIKAPFPMAQLKRNVFKDSRTK
VEGLRANATKRNTTLVQRAIDRTADDGGGWVVVPAGDWSVARITLKSGVNLHLEEGCNLH
FSGMIKDYRPAVFTRDEGTEVYSTGAFIYARGERNIALTGKGHIVGPDTGCELYQTNVPG
QANAEAAVKKDEPVESRVFDGKKENRGGAVLLPKSFCAIDCSNVLLEGVTFDRSLYWNIN
PIYCDSVIIRDVSVYSYGHGRTDGIDIESSRNVLIEYCTLDCQDDCYTLKSGRGWDGLRV
NRPTENVVVRNSVALRGAAGFVTGTETAGGIRNVYCTDCTFDGTDRAIRFKSRRTRGGLQ
ERIWVDNIKGRNIKHSAICVEMPGDSRWMGKLAARHPDMTDSVVAASLTKENTPAIRSIY
INNVDIESERALFDVVALSESKLKDFFVGDSRFACKTIGRLRDVAQCNLKDLRIESADTA
LVVDGCEKISVFRMNKAVVERGEPSKMVVVHDPMLDSDGKPIQAHAFQIVRRDSLYYWYG
ENKEKTIPGSNVSTYGVRCYTSRDFEHWDDRGLIMTPDTTDVTSYIHYSQKLERPHILQS
PKSGKFALWLKSQETRRVLLGAGRRMAAGD

Enzyme Prediction     

No EC number prediction in MGYG000002063_00072.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH106	361	712	2.1e-69	0.4368932038834951
GH28	865	1208	1.1e-56	0.8246153846153846

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17132	Glyco_hydro_106	2.16e-123	33	793	3	868	alpha-L-rhamnosidase.
COG5434	Pgu1	1.11e-58	852	1154	98	399	Polygalacturonase [Carbohydrate transport and metabolism].
cd18826	GH43_CtGH43-like	4.20e-36	1302	1391	1	90	Glycosyl hydrolase family 43 protein similar to Clostridium thermocellum exo-beta-1,3-galactanase CtGH43 and Ruminococcus champanellensis arabinanase Ara43A. This uncharacterized glycosyl hydrolase family 43 (GH43) subgroup belongs to a subgroup which includes characterized enzymes with exo-beta-1,3-galactanase (EC 3.2.1.145, also known as galactan 1,3-beta-galactosidase) activity such as Clostridium thermocellum (Ct1,3Gal43A or CtGH43) and Phanerochaete chrysosporium 1,3Gal43A (Pc1, 3Gal43A), and arabinanase (EC 3.2.1.99) activity such as Ruminococcus champanellensis Ara43A. GH43 are inverting enzymes (i.e. they invert the stereochemistry of the anomeric carbon atom of the substrate) that have an aspartate as the catalytic general base, a glutamate as the catalytic general acid and another aspartate that is responsible for pKa modulation and orienting the catalytic acid. Many GH43 enzymes display both alpha-L-arabinofuranosidase and beta-D-xylosidase activity using aryl-glycosides as substrates. A common structural feature of GH43 enzymes is a 5-bladed beta-propeller domain that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.
cd08985	GH43_CtGH43-like	6.10e-21	1302	1392	1	89	Glycosyl hydrolase family 43 protein such as Clostridium thermocellum exo-beta-1,3-galactanase CtGH43 and Ruminococcus champanellensis arabinanase Ara43A. This glycosyl hydrolase family 43 (GH43) subgroup includes characterized enzymes with exo-beta-1,3-galactanase (EC 3.2.1.145, also known as galactan 1,3-beta-galactosidase) activity such as Clostridium thermocellum (Ct1,3Gal43A or CtGH43) and Phanerochaete chrysosporium 1,3Gal43A (Pc1, 3Gal43A), and arabinanase (EC 3.2.1.99) activity such as Ruminococcus champanellensis Ara43A. GH43 are inverting enzymes (i.e. they invert the stereochemistry of the anomeric carbon atom of the substrate) that have an aspartate as the catalytic general base, a glutamate as the catalytic general acid and another aspartate that is responsible for pKa modulation and orienting the catalytic acid. Many GH43 enzymes display both alpha-L-arabinofuranosidase and beta-D-xylosidase activity using aryl-glycosides as substrates. A common structural feature of GH43 enzymes is a 5-bladed beta-propeller domain that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.
cd18825	GH43_CtGH43-like	2.59e-19	1302	1390	1	88	Glycosyl hydrolase family 43 protein similar to Clostridium thermocellum exo-beta-1,3-galactanase CtGH43 and Ruminococcus champanellensis arabinanase Ara43A. This uncharacterized glycosyl hydrolase family 43 (GH43) subgroup belongs to a subgroup which includes characterized enzymes with exo-beta-1,3-galactanase (EC 3.2.1.145, also known as galactan 1,3-beta-galactosidase) activity such as Clostridium thermocellum (Ct1,3Gal43A or CtGH43) and Phanerochaete chrysosporium 1,3Gal43A (Pc1, 3Gal43A), and arabinanase (EC 3.2.1.99) activity such as Ruminococcus champanellensis Ara43A. GH43 are inverting enzymes (i.e. they invert the stereochemistry of the anomeric carbon atom of the substrate) that have an aspartate as the catalytic general base, a glutamate as the catalytic general acid and another aspartate that is responsible for pKa modulation and orienting the catalytic acid. Many GH43 enzymes display both alpha-L-arabinofuranosidase and beta-D-xylosidase activity using aryl-glycosides as substrates. A common structural feature of GH43 enzymes is a 5-bladed beta-propeller domain that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALJ47717.1	4.99e-186	23	814	31	922
QRQ54617.1	4.99e-186	23	814	31	922
EDO11490.1	4.99e-186	23	814	31	922
SCV07115.1	4.99e-186	23	814	31	922
QUT59637.1	3.30e-182	815	1393	25	605

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MQM_A	2.10e-58	20	815	25	924	Glycosidehydrolase BT_0986 [Bacteroides thetaiotaomicron],5MQN_A Glycoside hydrolase BT_0986 [Bacteroides thetaiotaomicron]
5MWK_A	4.87e-58	20	815	25	924	Glycosidehydrolase BT_0986 [Bacteroides thetaiotaomicron]
6Q2F_A	2.10e-55	28	790	44	937	Structureof Rhamnosidase from Novosphingobium sp. PP1Y [Novosphingobium sp. PP1Y]
5OLP_A	1.58e-51	820	1249	26	446	Galacturonidase[Bacteroides thetaiotaomicron VPI-5482],5OLP_B Galacturonidase [Bacteroides thetaiotaomicron VPI-5482]
3JUR_A	1.92e-46	843	1252	34	429	Thecrystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_B The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_C The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_D The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KNA8	2.10e-58	30	813	34	740	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22040 PE=2 SV=1
P27644	8.46e-16	999	1208	28	234	Polygalacturonase OS=Rhizobium radiobacter OX=358 GN=pgl PE=2 SV=1
P26509	2.54e-08	853	1181	52	353	Endo-polygalacturonase OS=Pectobacterium parmentieri OX=1905730 GN=pehA PE=1 SV=1
P18192	4.45e-08	853	1181	52	353	Endo-polygalacturonase OS=Pectobacterium carotovorum subsp. carotovorum OX=555 GN=peh PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000248	0.999105	0.000158	0.000159	0.000146	0.000137

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002063_00072.