CAZyme Information: MGYG000002061_00622

Basic Information

• Species: QAMX01 sp004555605
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; QAMX01; QAMX01; QAMX01 sp004555605
• CAZyme ID: MGYG000002061_00622
• CAZy Family: GH35
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
582	MGYG000002061_11|CGC2	65740.49	5.2211

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002061	2191757	MAG	China	Asia

• Gene Location: Start: 32986; End: 34734 Strand: +

Full Sequence      

MPEFTYNGRDFLMDGQPYTVLSGAMHYPRIPRAYWRDRMLKLKECGFNTVETYTFWNLHE
PKEGEFHFDGICDIEAYVETAASLGLNVILRPGPYVCAEWECGGFPAWLLAYDGMHLRCN
DPLYLEKVRAYFAELFHRLRPHFAGNGGNIIMCQIENEYGSFGDDKDYLRALAQMYRDFG
VNCLLYTADGTCSWMLSGGTLDEFICVANFGSRVQSEFAALNAFRPGQPTMCGEFWCGWF
DHWYETHHTRTAEDIAAQFTEIAEAHASVNFYMFHGGTNFGFWNGANYDKWLQPTVTSYD
YCAPLTEAGDRTPAYYAIRDLVAHHFHPVPPLTAQESKKAAYGAVTLSEQALLFEQTQCL
GQMIRRPAPVYMEYLGQNFGYTLYSSVVSGPIGTLPLILEGAADRALIFINGVFRGIVEP
PHHSDQPELTLEKGEHARIDILVENMGRVNYGTHFADHKGLRGVRLGQRFHFGWAITPME
MDDLSALTFAPCTPISRQPVFLRGTLEIVGEPCDTFVRLDGFHKGFVVVNGFNIGRFYND
AGPQKTLYLPAPFLRAGRNEIIVFESDETSSNIITLTDTPVL

Enzyme Prediction     

EC	3.2.1.23	3.2.1.38	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH35	11	322	4.1e-120	0.990228013029316

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01301	Glyco_hydro_35	4.70e-149	10	321	1	314	Glycosyl hydrolases family 35.
COG1874	GanA	7.01e-59	4	569	1	593	Beta-galactosidase GanA [Carbohydrate transport and metabolism].
PLN03059	PLN03059	1.25e-51	5	321	31	338	beta-galactosidase; Provisional
pfam02449	Glyco_hydro_42	2.90e-11	27	160	3	139	Beta-galactosidase. This group of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. The enzyme catalyzes the hydrolysis of terminal, non-reducing terminal beta-D-galactosidase residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUS98261.1	8.23e-213	1	580	1	577
AZN39288.1	1.20e-204	1	582	1	584
QJD88406.1	9.05e-203	1	582	1	581
QAV16979.1	6.75e-202	1	580	1	583
QNK60278.1	7.33e-202	1	580	1	580

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4MAD_A	3.63e-187	1	582	15	593	ChainA, Beta-galactosidase [Niallia circulans],4MAD_B Chain B, Beta-galactosidase [Niallia circulans]
4E8C_A	2.15e-149	10	582	9	587	Crystalstructure of streptococcal beta-galactosidase in complex with galactose [Streptococcus pneumoniae TIGR4],4E8C_B Crystal structure of streptococcal beta-galactosidase in complex with galactose [Streptococcus pneumoniae TIGR4],4E8D_A Crystal structure of streptococcal beta-galactosidase [Streptococcus pneumoniae TIGR4],4E8D_B Crystal structure of streptococcal beta-galactosidase [Streptococcus pneumoniae TIGR4]
3THC_A	1.58e-131	1	582	8	621	Crystalstructure of human beta-galactosidase in complex with galactose [Homo sapiens],3THC_B Crystal structure of human beta-galactosidase in complex with galactose [Homo sapiens],3THC_C Crystal structure of human beta-galactosidase in complex with galactose [Homo sapiens],3THC_D Crystal structure of human beta-galactosidase in complex with galactose [Homo sapiens],3THD_A Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens],3THD_B Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens],3THD_C Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens],3THD_D Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens]
7KDV_A	2.20e-131	3	582	17	629	ChainA, Beta-galactosidase [Mus musculus],7KDV_C Chain C, Beta-galactosidase [Mus musculus],7KDV_E Chain E, Beta-galactosidase [Mus musculus],7KDV_G Chain G, Beta-galactosidase [Mus musculus],7KDV_I Chain I, Beta-galactosidase [Mus musculus],7KDV_K Chain K, Beta-galactosidase [Mus musculus]
3WEZ_A	3.13e-131	1	582	32	645	Crystalstructure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WEZ_B Crystal structure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WEZ_C Crystal structure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WEZ_D Crystal structure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WF0_A Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF0_B Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF0_C Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF0_D Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF1_A Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF1_B Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF1_C Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF1_D Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF2_A Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens],3WF2_B Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens],3WF2_C Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens],3WF2_D Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P48982	4.72e-140	2	549	28	573	Beta-galactosidase OS=Xanthomonas manihotis OX=43353 GN=bga PE=1 SV=1
Q58D55	2.41e-133	3	565	32	619	Beta-galactosidase OS=Bos taurus OX=9913 GN=GLB1 PE=2 SV=1
Q6UWU2	2.18e-131	11	568	39	609	Beta-galactosidase-1-like protein OS=Homo sapiens OX=9606 GN=GLB1L PE=2 SV=1
Q8VC60	6.84e-131	11	582	35	619	Beta-galactosidase-1-like protein OS=Mus musculus OX=10090 GN=Glb1l PE=1 SV=1
O19015	1.33e-130	3	565	34	622	Beta-galactosidase OS=Felis catus OX=9685 GN=GLB1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000048	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002061_00622.