CAZyme Information: MGYG000002051_02396

Basic Information

• Species: Prevotella sp900546345
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900546345
• CAZyme ID: MGYG000002051_02396
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
384		43915.82	8.5384

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002051	3257941	MAG	China	Asia

• Gene Location: Start: 9668; End: 10822 Strand: -

Full Sequence      

MKYYLIAGEASGDLHASRLMISLKQRDPEAVFRFIGGNMMATVGGKPFRHYKELAYMGFV
PVILHARTILRNMAQCKQDIVSWAPDVVILVDYPGFNLSIAKFVHAQVGIPVFYYISPKI
WAWKEWRIKAIRRDVDELFSILPFEVDFYEKKHHYPIHYVGNPTAEEIQTFRNNYHESKD
AFCFRHGLNPERPILALLAGSRKQEIKDNLPTMIAAAQPYCQKANGYQMVLAGAPSIEDD
YYRPFLRGQHVTKLTEETYELLTHATTALVTSGTATLETALLGVPQVVCYKTPVGPLIRW
AFNHIIQCRFISLVNLIADREVVTELFADRFSVENIRHELDRIRPGQPDRTAMLQGYRLV
AERLGQQSAPDTTAEEMIKILKKQ

Enzyme Prediction     

No EC number prediction in MGYG000002051_02396.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	364	1.2e-111	0.9887005649717514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	1.91e-106	1	384	2	378	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	1.90e-101	1	383	2	381	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	4.52e-70	4	326	2	321	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	8.62e-59	5	336	10	337	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	3.39e-53	1	384	2	347	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUB72247.1	3.57e-183	1	381	1	376
QUB84094.1	5.09e-182	1	381	1	376
QKH89215.1	6.58e-182	1	381	1	376
QUB78097.1	9.34e-182	1	381	1	376
QUB61849.1	9.34e-182	1	381	1	376

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	1.36e-31	5	329	11	330	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	3.59e-31	5	329	11	330	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q1D393	1.10e-66	5	381	9	378	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1
Q74AT9	1.63e-62	5	384	11	383	Lipid-A-disaccharide synthase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) OX=243231 GN=lpxB PE=3 SV=1
B3E4H8	2.23e-62	5	365	11	364	Lipid-A-disaccharide synthase OS=Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) OX=398767 GN=lpxB PE=3 SV=1
Q39T49	1.93e-60	5	383	11	382	Lipid-A-disaccharide synthase OS=Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15) OX=269799 GN=lpxB PE=3 SV=1
Q6ALW0	9.34e-58	5	381	14	386	Lipid-A-disaccharide synthase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) OX=177439 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000076	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002051_02396.