CAZyme Information: MGYG000002037_00904

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; SFJ001
• CAZyme ID: MGYG000002037_00904
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
308	MGYG000002037_22|CGC1	34459.5	8.1563

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002037	2039797	MAG	China	Asia

• Gene Location: Start: 19580; End: 20506 Strand: +

Full Sequence      

MERVAAVVVTYNRKELLAQCIKALLGQQNAVCDILIVDNASTDGTGAYLAALNEPRVHSR
STGANLGGAGGFNFGMRWAVEAGYDLVWIMDDDTLPHPDSLAQLLAAHTILGGNYGFLSS
AVLWTDGTECKMNRQKIKKNFYEHVELLRHGLILVEQATFVSLLFPAAAIEKAGLPIRDF
FIWGDDIEYTRRMTVRLGLPCYLAGQSQVTHAMKENNGSSIALDSPERISRYRYAFRNEN
YTYRHEGVRGVCYYIAKCGLNLCRIWAKAPGQRLRRSWIILSRMVSGLWFNPKVEQVHRP
EAAVDSAE

Enzyme Prediction     

No EC number prediction in MGYG000002037_00904.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	6	107	2e-22	0.5941176470588235

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04185	GT_2_like_b	3.28e-73	6	242	1	202	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	1.47e-41	1	282	2	295	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd02526	GT2_RfbF_like	4.01e-24	6	238	1	232	RfbF is a putative dTDP-rhamnosyl transferase. Shigella flexneri RfbF protein is a putative dTDP-rhamnosyl transferase. dTDP rhamnosyl transferases of Shigella flexneri add rhamnose sugars to N-acetyl-glucosamine in the O-antigen tetrasaccharide repeat. Lipopolysaccharide O antigens are important virulence determinants for many bacteria. The variations of sugar composition, the sequence of the sugars and the linkages in the O antigen provide structural diversity of the O antigen.
cd04186	GT_2_like_c	4.92e-24	7	211	2	164	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
pfam00535	Glycos_transf_2	9.85e-21	7	107	3	102	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
APG75322.1	1.87e-94	1	297	1	296
QID93864.1	1.93e-94	1	297	1	296
QSH35424.1	1.93e-94	1	297	1	296
AWV30641.1	1.93e-94	1	297	1	296
QQO43441.1	1.93e-94	1	297	1	296

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A0R5Z2	3.03e-16	2	249	5	261	Galactofuranosyltransferase GlfT1 OS=Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) OX=246196 GN=glfT1 PE=1 SV=1
P9WMX2	8.08e-12	2	301	3	295	Galactofuranosyltransferase GlfT1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=glfT1 PE=3 SV=1
P9WMX3	8.08e-12	2	301	3	295	Galactofuranosyltransferase GlfT1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=glfT1 PE=1 SV=1
C5CBV8	3.21e-10	3	107	2	107	Undecaprenyl-phosphate mannosyltransferase OS=Micrococcus luteus (strain ATCC 4698 / DSM 20030 / JCM 1464 / NBRC 3333 / NCIMB 9278 / NCTC 2665 / VKM Ac-2230) OX=465515 GN=Mlut_12000 PE=1 SV=1
P33697	1.00e-07	4	132	12	137	Succinoglycan biosynthesis protein ExoO OS=Rhizobium meliloti (strain 1021) OX=266834 GN=exoO PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000070	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002037_00904.