CAZyme Information: MGYG000002034_00936

Basic Information

• Species: CAG-170 sp900553545
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Oscillospiraceae; CAG-170; CAG-170 sp900553545
• CAZyme ID: MGYG000002034_00936
• CAZy Family: GT5
• CAZyme Description: Glycogen synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
478	MGYG000002034_29|CGC1	53944.78	5.9542

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002034	1981843	MAG	China	Asia

• Gene Location: Start: 17895; End: 19331 Strand: +

Full Sequence      

MKIAFLASECAPYLKTGGLGDVVQALPEALSKLPKVEVSVFLPYYSRIKYSGQWKTDFLG
YFDVQLAWRREYVGIFRLKTRKKKLQVYFLDNEQYFNRPSAYGYPDDGERFAYFSRACLE
SLRYLGMQPDIVHCHDWQTALVPMLLNMQYRGDFPNMRSILTIHNIEYQGKCGLDFNRDV
LGAPPQCDEILRFDDCQNFLKAGIVMADRVGTVSKTYAEELRYPYYAHGLSEILASRGEA
FSGIVNGINMALFDPEKNPNLAEHYSIKTMREGKTANKLALQQRLGLPEDKDTALLVMVT
RLAGHKGIDLLCYIAERLLQRRVQLAVLGTGEEKYEWFLSGLQYRFPQQVAAHLVFDADL
ADLAYAAADLYLMPSKAEPCGLSQLIAMRYGTVPVVNATGGLRDTVTPYDPTTGAGRGFT
FQSYNADDFLASIDRALALYYDAPEQFAALAQQDMLVDSSWTLPAKEYMQLYQSVCGG

Enzyme Prediction     

No EC number prediction in MGYG000002034_00936.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT5	2	473	1.3e-164	0.9957627118644068

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03791	GT5_Glycogen_synthase_DULL1-like	0.0	2	474	1	474	Glycogen synthase GlgA and similar proteins. This family is most closely related to the GT5 family of glycosyltransferases. Glycogen synthase (EC:2.4.1.21) catalyzes the formation and elongation of the alpha-1,4-glucose backbone using ADP-glucose, the second and key step of glycogen biosynthesis. This family includes starch synthases of plants, such as DULL1 in Zea mays and glycogen synthases of various organisms.
PRK00654	glgA	0.0	1	477	1	465	glycogen synthase GlgA.
TIGR02095	glgA	2.78e-180	1	475	1	473	glycogen/starch synthase, ADP-glucose type. This family consists of glycogen (or starch) synthases that use ADP-glucose (EC 2.4.1.21), rather than UDP-glucose (EC 2.4.1.11) as in animals, as the glucose donor. This enzyme is found in bacteria and plants. Whether the name given is glycogen synthase or starch synthase depends on context, and therefore on substrate. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
COG0297	GlgA	1.29e-157	1	475	1	478	Glycogen synthase [Carbohydrate transport and metabolism].
PRK14099	PRK14099	4.73e-94	1	475	4	479	glycogen synthase GlgA.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOY33768.1	3.63e-140	1	478	1	474
AGX05960.1	1.14e-139	1	478	1	477
BCI60006.1	8.29e-139	1	477	1	474
QLY80212.1	3.56e-138	1	475	1	474
CAB1243454.1	4.72e-138	1	475	1	471

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6GNE_A	7.06e-79	1	472	10	494	Catalyticdomain of Starch Synthase IV from Arabidopsis thaliana bound to ADP and acarbose [Arabidopsis thaliana],6GNE_B Catalytic domain of Starch Synthase IV from Arabidopsis thaliana bound to ADP and acarbose [Arabidopsis thaliana]
3D1J_A	2.10e-71	1	472	1	473	ChainA, Glycogen synthase [Escherichia coli]
2QZS_A	3.60e-71	1	472	1	473	CrystalStructure of Wild-type E.coli GS in complex with ADP and Glucose(wtGSb) [Escherichia coli],2R4T_A Crystal Structure of Wild-type E.coli GS in Complex with ADP and Glucose(wtGSc) [Escherichia coli],2R4U_A Crystal Structure of Wild-type E.coli GS in complex with ADP and Glucose(wtGSd) [Escherichia coli],3GUH_A Crystal Structure of Wild-type E.coli GS in complex with ADP and DGM [Escherichia coli K-12]
3COP_A	2.74e-70	1	472	1	473	ChainA, Glycogen synthase [Escherichia coli],3CX4_A Chain A, Glycogen synthase [Escherichia coli]
4HLN_A	7.62e-67	2	473	126	623	Structureof barley starch synthase I in complex with maltooligosaccharide [Hordeum vulgare]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8XPA1	6.40e-133	1	475	7	480	Glycogen synthase OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=glgA PE=3 SV=1
C4Z0G2	4.52e-132	2	475	3	478	Glycogen synthase OS=Lachnospira eligens (strain ATCC 27750 / DSM 3376 / VPI C15-48 / C15-B4) OX=515620 GN=glgA PE=3 SV=1
B1YK70	1.21e-130	1	475	1	478	Glycogen synthase OS=Exiguobacterium sibiricum (strain DSM 17290 / CIP 109462 / JCM 13490 / 255-15) OX=262543 GN=glgA PE=3 SV=1
A4IS20	1.29e-130	1	475	1	474	Glycogen synthase OS=Geobacillus thermodenitrificans (strain NG80-2) OX=420246 GN=glgA PE=3 SV=1
Q3K1K2	1.93e-130	1	475	1	475	Glycogen synthase OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) OX=205921 GN=glgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000058	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002034_00936.