CAZyme Information: MGYG000002033_02281

Basic Information

• Species: Parabacteroides massiliensis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides massiliensis
• CAZyme ID: MGYG000002033_02281
• CAZy Family: GH127
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
625	MGYG000002033_24|CGC2	70551.59	7.3686

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002033	4100607	MAG	Spain	Europe

• Gene Location: Start: 55773; End: 57650 Strand: -

Full Sequence      

MIIPFKVKTFSFLLACACSTAAMAQVVNDSPVRHVKISGYVGTRIADCIEHRVKAQDVDH
LVEPFRHQNEQSRWQSEFWGKWIQGAIASYRYNRDPELYRIIKKAAESLMATQQPDGYIG
NYAPEYQLQQWDVWGRKYTSLGLIAWYDLSEDKKALEAACKVVDHLMTQVGPGKVDIVST
GNYIGMPSSSVLEPVMYLYNRTKEKRYLDFAQYIVGQWETPGGPQLISKAIADVPVANRF
PHPKTWFSRENGQKAYEMMSCYEGLLELYKVTGNPLYLSVVEKTVGHIVREEINVAGSGS
AFECWYGGKERQTQPTYHTMETCVTFTWMQLCNRLLQITGNSLYADYMETAIYNALMASL
KADASQIAKYSPLEGWRHEGEEQCGMHINCCNANGPRAFAMIPGFAYQVQDDCVRVNFYA
PSEAELVLPGKKTVRLKQTTDYPQTDQIEIEVDPAKETAFTIALRIPAWSRIATVSVNGK
PEDGVLPGAYLSVNRKWKKGDRITVKLDLRARLVECNQAQAIVRGPLVLARDSRFGDGFV
DETAVVVSKDGYVELTPVEAPGFAWMAFTAPMVLGTDLESNRAPKQIHLCDFASAGNTWD
KTQRYRVWLPKTLNVMHSPYKPYNQ

Enzyme Prediction     

No EC number prediction in MGYG000002033_02281.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH127	67	529	8.2e-67	0.9122137404580153

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	1.14e-74	57	530	24	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	2.63e-67	40	530	29	501	Uncharacterized conserved protein, DUF1680 family [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ARE60508.1	1.31e-239	28	625	20	622
QOY86860.1	9.03e-50	81	528	97	547
AXC10260.1	2.03e-46	81	531	133	592
ADH61394.1	3.76e-45	31	528	13	557
ACM22580.1	1.80e-44	81	550	83	554

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6EX6_A	9.04e-37	81	535	74	553	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]
4QJY_A	8.37e-34	47	528	40	558	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	1.64e-31	47	528	40	558	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
5MQO_A	8.57e-28	81	533	105	610	Glycosidehydrolase BT_1003 [Bacteroides thetaiotaomicron]
3WRE_A	2.15e-23	81	597	80	646	Thecrystal structure of native HypBA1 from Bifidobacterium longum JCM 1217 [Bifidobacterium longum subsp. longum JCM 1217],3WRG_A The complex structure of HypBA1 with L-arabinose [Bifidobacterium longum subsp. longum JCM 1217]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
E8MGH8	1.18e-22	81	597	80	646	Non-reducing end beta-L-arabinofuranosidase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=hypBA1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001281	0.602446	0.395374	0.000365	0.000281	0.000236

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002033_02281.