CAZyme Information: MGYG000002033_01095

Basic Information

• Species: Parabacteroides massiliensis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides massiliensis
• CAZyme ID: MGYG000002033_01095
• CAZy Family: PL35
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
606	MGYG000002033_9|CGC2	68417.77	7.2992

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002033	4100607	MAG	Spain	Europe

• Gene Location: Start: 48710; End: 50530 Strand: -

Full Sequence      

MRLINLVGLFFLLFSFTMTGRNLLVRQSGKELRQHPRLLFSKQEEQRIRDLFGTEPLLDS
LRASLMKEAERLLAVPPQEDPRRKIKNTKDILSVSREQVYRMVNLALAYRLSGERRFAEK
AEKELVHVCNFSDWDPIHYLDVAEMTTAVAIGYDWLYDVLAPVTRQLVVHSIKTKALDFV
VEEYKTGNADSWAKRETNWNVVCNTGMVLGALAIEEHYPELAKHIIGEAVRYIPNCLKHF
APDGVCYEGPAYWGYTNMYLSLLLKALNDNLGEDFGLSKMKGVDKSVLYYMHSTSPSGKI
FNFANSGSTAPAAEPIYFYFSRAFNQPEVADFYRNILSKTVQGGNYFRFYFLSIPWYDTA
SSPADALPKLKVYEGINDIIVFNGNRNVSNSLYLIAKTGDPDMAHQQLDIGTFIVETNGI
RWTDDLGADNYSLPGFWDYKPDGQRWSYFRNSNFSHNTLSIDHKLQNSAGTGKIKQQDDK
AAQPFVTMDMSTAYAGQSRFVYRTFRMLDDTHILVTDSIGLQSPSQSVQWSVITSADVEN
KGNTVVLRKDGKSFSLKITLPTNASFTTKTAKRGSEAEKPIEGYTILSASVSGEPVQVIK
VLLSGE

Enzyme Prediction     

No EC number prediction in MGYG000002033_01095.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL35	390	561	1.1e-53	0.9776536312849162

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam16332	DUF4962	2.85e-07	21	176	127	290	Domain of unknown function (DUF4962). This family consists of uncharacterized proteins around 870 residues in length and is mainly found in various Bacteroides species. The function of this protein is unknown.
pfam07940	Hepar_II_III	6.10e-06	389	519	19	150	Heparinase II/III-like protein. This family features sequences that are similar to a region of the Flavobacterium heparinum proteins heparinase II and heparinase III. The former is known to degrade heparin and heparin sulphate, whereas the latter predominantly degrades heparin sulphate. Both are secreted into the periplasmic space upon induction with heparin.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT50039.1	0.0	1	606	1	606
QRP59764.1	5.26e-195	7	589	6	580
QQT79787.1	5.26e-195	7	589	6	580
ASM65217.1	7.61e-195	7	589	17	591
QUU07041.1	3.00e-194	7	589	6	580

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3A0O_A	1.21e-07	35	530	139	657	Crystalstructure of alginate lyase from Agrobacterium tumefaciens C58 [Agrobacterium fabrum str. C58],3A0O_B Crystal structure of alginate lyase from Agrobacterium tumefaciens C58 [Agrobacterium fabrum str. C58]
3AFL_A	1.90e-06	35	530	139	657	Crystalstructure of exotype alginate lyase Atu3025 H531A complexed with alginate trisaccharide [Agrobacterium fabrum str. C58]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.285159	0.707873	0.006127	0.000256	0.000248	0.000320

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002033_01095.