CAZyme Information: MGYG000002027_01196

Basic Information

• Species: HGM11377 sp900755035
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-917; HGM11377; HGM11377 sp900755035
• CAZyme ID: MGYG000002027_01196
• CAZy Family: GH36
• CAZyme Description: Alpha-galactosidase AgaA

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
723	MGYG000002027_4|CGC3	84382.48	5.4053

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002027	1634201	MAG	Spain	Europe

• Gene Location: Start: 148972; End: 151143 Strand: +

Full Sequence      

MAIKFFKDRNLFHLYNSEFSYYVHIHESKAITCPYFGSYLDDIDLDQISVIGGEDWFSNY
YDYEEKAEKKYENLYLNASKMLLPSYRAADVRPSFVKIDGLENNKLDFRYVSHKILKGKP
QLVDMPYIRDDLSEAETLEITAKDFSKDVTIILSLSIFENYNVIIRNTKFINGTDKNLWL
TKSMSLTQDFASANYDLIHFPGEWLFERQFRRERITEGTKVISSKTGRSSHEHNPFIMLA
DPSATETNGEVFAVSFMYSGAFKCEVNVGKVGVTRINIGIGDFRYEVKSKESFIFPEGFI
VYGKNGFESVSHQLHDLTRERIVIDNNEDVYRSILLNSWEGCYMDFNTEKVLNFITEGKK
MGAELFVLDDGWFGNRCDDKRALGDWQVNEEKINLNKVIDECHKNGMKFGIWIEPEMANF
DSNLLREHPEYAAVDVKSNPWLSRHQVMLNFANDEVVDYIYNVLEATLSRYEIDYIKWDH
NRTMEDYFADNLDYLHQDEFYHRNTLGYYKLADRLTKRFANVHFQGCASGGGRFDFGTLF
YFPEIWTSDENDPIQRLFIQYGTSFAYPPSVMGAHVNECDTASYKTKSEIALFGSYGFEL
DPRRVADKDIEQIKITNEIYKKYRDVVLKGDLFRLSSPFETNEFSIIMVDKNKEKALFLM
VNLLKRLRASRFIKLRGLNPNKKYINSLDNKTYKGSYYMEVGINMSKTLNEFESQLVVLE
EIK

Enzyme Prediction     

No EC number prediction in MGYG000002027_01196.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH36	11	704	1.6e-200	0.997093023255814

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02065	Melibiase	8.25e-135	292	630	1	347	Melibiase. Glycoside hydrolase families GH27, GH31 and GH36 form the glycoside hydrolase clan GH-D. Glycoside hydrolase family 36 can be split into 11 families, GH36A to GH36K. This family includes enzymes from GH36A-B and GH36D-K and from GH27.
COG3345	GalA	4.83e-127	76	706	52	668	Alpha-galactosidase [Carbohydrate transport and metabolism].
cd14791	GH36	1.07e-105	331	622	1	299	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
pfam16875	Glyco_hydro_36N	1.64e-71	35	283	7	249	Glycosyl hydrolase family 36 N-terminal domain. This domain is found at the N-terminus of many family 36 glycoside hydrolases. It has a beta-supersandwich fold.
pfam16874	Glyco_hydro_36C	7.22e-15	648	719	6	78	Glycosyl hydrolase family 36 C-terminal domain. This domain is found at the C-terminus of many family 36 glycoside hydrolases. It has a beta-sandwich structure with a Greek key motif.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANX00450.1	1.10e-161	1	723	1	732
AGI38523.1	4.37e-161	1	723	1	732
AGC67465.1	4.37e-161	1	723	1	732
ANW97899.1	4.37e-161	1	723	1	732
ADU29369.1	8.23e-160	1	723	1	737

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4FNQ_A	4.51e-148	1	723	1	728	Crystalstructure of GH36 alpha-galactosidase AgaB from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
4FNR_A	1.97e-146	84	723	77	728	Crystalstructure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNR_B Crystal structure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNR_C Crystal structure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNR_D Crystal structure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
2XN2_A	2.37e-145	3	716	6	725	Structureof alpha-galactosidase from Lactobacillus acidophilus NCFM with galactose [Lactobacillus acidophilus NCFM]
2XN0_A	3.34e-145	3	716	6	725	Structureof alpha-galactosidase from Lactobacillus acidophilus NCFM, PtCl4 derivative [Lactobacillus acidophilus NCFM],2XN0_B Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM, PtCl4 derivative [Lactobacillus acidophilus NCFM],2XN1_A Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM with TRIS [Lactobacillus acidophilus NCFM],2XN1_B Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM with TRIS [Lactobacillus acidophilus NCFM],2XN1_C Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM with TRIS [Lactobacillus acidophilus NCFM],2XN1_D Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM with TRIS [Lactobacillus acidophilus NCFM]
4FNU_A	6.08e-145	84	723	77	728	Crystalstructure of GH36 alpha-galactosidase AgaA A355E D478A from Geobacillus stearothermophilus in complex with stachyose [Geobacillus stearothermophilus],4FNU_B Crystal structure of GH36 alpha-galactosidase AgaA A355E D478A from Geobacillus stearothermophilus in complex with stachyose [Geobacillus stearothermophilus],4FNU_C Crystal structure of GH36 alpha-galactosidase AgaA A355E D478A from Geobacillus stearothermophilus in complex with stachyose [Geobacillus stearothermophilus],4FNU_D Crystal structure of GH36 alpha-galactosidase AgaA A355E D478A from Geobacillus stearothermophilus in complex with stachyose [Geobacillus stearothermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9ALJ4	1.08e-145	84	723	77	728	Alpha-galactosidase AgaA OS=Geobacillus stearothermophilus OX=1422 GN=agaA PE=1 SV=1
G1UB44	1.83e-144	3	716	6	725	Alpha-galactosidase Mel36A OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) OX=272621 GN=melA PE=1 SV=1
G4T4R7	8.51e-142	1	723	1	721	Bifunctional alpha-galactosidase/sucrose kinase AgaSK OS=Ruminococcus gnavus OX=33038 GN=agaSK PE=1 SV=1
P43467	1.06e-128	11	702	12	710	Alpha-galactosidase 1 OS=Pediococcus pentosaceus OX=1255 GN=agaR PE=3 SV=1
Q92457	6.38e-127	107	721	118	744	Alpha-galactosidase 2 OS=Hypocrea jecorina OX=51453 GN=agl2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000033	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002027_01196.