CAZyme Information: MGYG000002027_00336

Basic Information

• Species: HGM11377 sp900755035
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-917; HGM11377; HGM11377 sp900755035
• CAZyme ID: MGYG000002027_00336
• CAZy Family: GH33
• CAZyme Description: Sialidase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
429	MGYG000002027_1|CGC3	48077.56	6.3696

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002027	1634201	MAG	Spain	Europe

• Gene Location: Start: 357275; End: 358564 Strand: -

Full Sequence      

MQIFSKELNRAGNYRVPSIITTKNGVVVACCDERWYGGGDNPNLIGKVVRRSFDSGKTWQ
DVIVVKEEVGKAKMTSSSSIDACMLYDEETNGIFMIYTHTPAGVGILASSKGIGETKEGY
RLVYDGKKEGYVKDGEVIMDGEVVAKVDEKGNVTSGEESLGNIYERDGKYKEKNTFFLYI
QSSFDDGATWSEPVCLNNQVKEKYMSFIGAGPGTGIVIKNGKYKGRYIFPIYYNTAGGRI
LMLSNAVIYSDDQGKTWHRGKSPNDKRKVLFYKVNEKFVMPNDMITESQVIELPNGDLKI
FMRNHNPKRRILTAISCDGGESWQDVKYQEQLTHCICQCSVINVKDEKGEATVFLNAADT
KARKNGVVRLSYDYGETFPYSRVLTEGEFVYSSMTMMPNGEIGVLYEGSTMHEAIEFTTI
TTKWIKGEE

Enzyme Prediction     

No EC number prediction in MGYG000002027_00336.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH33	8	419	2.6e-89	0.9502923976608187

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd15482	Sialidase_non-viral	1.35e-90	3	421	3	339	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
pfam13088	BNR_2	2.24e-18	175	404	79	280	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
COG4409	NanH	3.79e-17	14	407	275	700	Neuraminidase (sialidase) [Carbohydrate transport and metabolism, Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUS96375.1	3.60e-118	3	428	40	471
SQI63205.1	5.64e-105	3	426	9	445
AKK05320.1	5.31e-88	3	425	333	762
QRP14191.1	7.13e-85	3	428	318	784
ACR18588.1	2.72e-84	3	428	318	784

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2BF6_A	2.03e-82	1	426	10	447	AtomicResolution Structure of the bacterial sialidase NanI from Clostridium perfringens in complex with alpha-Sialic Acid (Neu5Ac). [Clostridium perfringens]
2VK5_A	2.21e-82	1	426	10	447	TheStructure Of Clostridium Perfringens Nani Sialidase And Its Catalytic Intermediates [Clostridium perfringens],2VK6_A The Structure Of Clostridium Perfringens Nani Sialidase And Its Catalytic Intermediates [Clostridium perfringens],2VK7_A The Structure Of Clostridium Perfringens Nani Sialidase And Its Catalytic Intermediates [Clostridium perfringens],2VK7_B The Structure Of Clostridium Perfringens Nani Sialidase And Its Catalytic Intermediates [Clostridium perfringens]
5TSP_A	1.12e-81	1	426	11	448	Crystalstructure of the catalytic domain of Clostridium perfringens neuraminidase (NanI) in complex with a CHES [Clostridium perfringens ATCC 13124],5TSP_B Crystal structure of the catalytic domain of Clostridium perfringens neuraminidase (NanI) in complex with a CHES [Clostridium perfringens ATCC 13124]
2YA4_A	1.80e-69	13	407	46	469	Crystalstructure of Streptococcus pneumoniae NanA (TIGR4) [Streptococcus pneumoniae TIGR4],2YA4_B Crystal structure of Streptococcus pneumoniae NanA (TIGR4) [Streptococcus pneumoniae TIGR4],2YA5_A Crystal structure of Streptococcus pneumoniae NanA (TIGR4) in complex with sialic acid [Streptococcus pneumoniae TIGR4],2YA5_B Crystal structure of Streptococcus pneumoniae NanA (TIGR4) in complex with sialic acid [Streptococcus pneumoniae TIGR4],2YA6_A Crystal structure of Streptococcus pneumoniae NanA (TIGR4) in complex with DANA [Streptococcus pneumoniae TIGR4],2YA6_B Crystal structure of Streptococcus pneumoniae NanA (TIGR4) in complex with DANA [Streptococcus pneumoniae TIGR4],2YA7_A Crystal structure of Streptococcus pneumoniae NanA (TIGR4) in complex with Zanamivir [Streptococcus pneumoniae TIGR4],2YA7_B Crystal structure of Streptococcus pneumoniae NanA (TIGR4) in complex with Zanamivir [Streptococcus pneumoniae TIGR4],2YA7_C Crystal structure of Streptococcus pneumoniae NanA (TIGR4) in complex with Zanamivir [Streptococcus pneumoniae TIGR4],2YA7_D Crystal structure of Streptococcus pneumoniae NanA (TIGR4) in complex with Zanamivir [Streptococcus pneumoniae TIGR4],2YA8_A Crystal structure of Streptococcus pneumoniae NanA (TIGR4) in complex with Oseltamivir carboxylate [Streptococcus pneumoniae TIGR4],2YA8_B Crystal structure of Streptococcus pneumoniae NanA (TIGR4) in complex with Oseltamivir carboxylate [Streptococcus pneumoniae TIGR4]
5KKY_A	1.93e-69	13	407	49	472	Structureof Streptococcus pneumonia NanA bound with inhibitor 9N3Neu5Ac2en [Streptococcus pneumoniae],5KKY_B Structure of Streptococcus pneumonia NanA bound with inhibitor 9N3Neu5Ac2en [Streptococcus pneumoniae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P29767	1.49e-72	1	428	382	829	Sialidase OS=Clostridium septicum OX=1504 PE=3 SV=1
P62575	7.03e-65	13	407	345	768	Sialidase A OS=Streptococcus pneumoniae OX=1313 GN=nanA PE=1 SV=1
P62576	7.03e-65	13	407	345	768	Sialidase A OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=nanA PE=1 SV=1
Q27701	2.25e-30	4	407	282	729	Anhydrosialidase OS=Macrobdella decora OX=6405 PE=1 SV=1
Q02834	1.48e-25	13	427	66	403	Sialidase OS=Micromonospora viridifaciens OX=1881 GN=nedA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000049	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002027_00336.