CAZyme Information: MGYG000002026_00574

Basic Information

• Species: HGM13010 sp900754965
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Oscillospiraceae; HGM13010; HGM13010 sp900754965
• CAZyme ID: MGYG000002026_00574
• CAZy Family: GT39
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
590		66754.96	8.1221

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002026	1935247	MAG	Spain	Europe

• Gene Location: Start: 62084; End: 63856 Strand: -

Full Sequence      

MSISLIFPILLAGWIVWLGYRFAETCINGARLSPAGASGRMTRADALLMAGITLLYGCTA
FWNLGDQTAPETFYKFPTADSQVVLELPEEQTVGQVLYYTGLNTGKYTISASRNGQDWQE
LGTLEQRHSMLFSWREGEMEPFSAKYVKLTSDSPLYLGSVVLRDLDGTEILLQTEQGAGA
LLDEREVTPISPSYLNGTYFDEIYHARTAYENVENVYPYETSHPPLGKLIISVGIRLFGM
TPFGWRCMGTLTGVLMLPVLYLFLKRLFGNTSVAACGTVIFAFDFMHYTQTRIATIDSYA
VLFILMMYYFMYRFVTERKLWCLALSGISFGLGAASKWTCIYAGAGLALLWLLHWIFRMK
KERDFRALGKNILFCLLFFVAIPGVIYYMSYYPYGRAIGLEGVSMYFDPSYAKLVWNNQV
GMLTYHVGVDATHPYSSRWYQWIFDARPILYYLDYGPAGTKSAIAAFVSPLLCWGGLFAM
VGMGYLAFWKRDQKAGFILIGYLAQLVPWMFVGRITFEYHYFACTVFLTLAVCYALDVIR
RHRPGGIKMLYAFTGISVGLFVLFLPVLSGLWANTSFTGAFLKWFPSWPL

Enzyme Prediction     

No EC number prediction in MGYG000002026_00574.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT39	195	394	4.5e-56	0.9192825112107623

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam16192	PMT_4TMC	8.67e-18	416	586	4	198	C-terminal four TMM region of protein-O-mannosyltransferase. PMT_4TMC is the C-terminal four membrane-pass region of protein-O-mannosyltransferases and similar enzymes.
COG1928	PMT1	1.51e-17	183	392	51	265	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].
pfam02366	PMT	1.40e-15	193	393	16	239	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
pfam13231	PMT_2	3.92e-14	222	342	1	120	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
COG1928	PMT1	2.95e-12	419	588	505	693	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANU42918.1	8.83e-159	3	589	11	652
QQR07704.1	8.83e-159	3	589	11	652
QIA32159.1	1.40e-156	3	589	7	648
ALP95330.1	1.56e-152	41	589	72	751
QBB67038.1	3.11e-152	41	589	72	751

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P9WN04	4.28e-23	200	588	73	521	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=pmt PE=3 SV=2
P9WN05	4.28e-23	200	588	73	521	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=pmt PE=1 SV=2
L8F4Z2	1.77e-21	191	588	58	515	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycolicibacterium smegmatis (strain MKD8) OX=1214915 GN=pmt PE=3 SV=1
Q8NRZ6	1.24e-16	223	588	99	519	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) OX=196627 GN=pmt PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000026	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
242	264
293	315
330	352
372	394
466	488
495	512
517	539
551	573