CAZyme Information: MGYG000001994_02449

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Schaedlerella
• CAZyme ID: MGYG000001994_02449
• CAZy Family: CE6
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
274		31155.28	5.4376

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001994	2695341	MAG	Spain	Europe

• Gene Location: Start: 3484; End: 4308 Strand: +

Full Sequence      

MKSVLLVGQSNMAGRGYISETKPIINERIWMLRNGRWQMMAEPIHFDRAVSGVGPAASFA
EKWCIDNPKEQIGLIPCAEGGSSIDEWRIDGTLFRHAVSEAKFALENSELIAILWHQGEN
DSSAGKYKEYYNKLEIIVEEFRNTLGQVPFIIGGLGDYLGKTGFGAHCTEYELVNRELYK
FATEKQECYFVTGSNLYSNPDGIHINAESQRRFGLRYYEAFDKKKHITAPLSDEYQQVDE
LLSREHTSSEKQYIALEKFTLGKISLEEVMATLK

Enzyme Prediction     

No EC number prediction in MGYG000001994_02449.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE6	54	145	9.2e-29	0.9797979797979798

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam03629	SASA	9.14e-62	5	223	6	226	Carbohydrate esterase, sialic acid-specific acetylesterase. The catalytic triad of this esterase enzyme comprises residues Ser127, His403 and Asp391 in UniProtKB:P70665.
cd01825	SGNH_hydrolase_peri1	0.002	81	223	34	187	SGNH_peri1; putative periplasmic member of the SGNH-family of hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW78361.1	5.60e-139	1	273	1	275
QLI44935.1	1.11e-129	1	273	1	275
QNP17465.1	8.91e-127	1	273	1	276
QRF33409.1	2.46e-126	1	273	1	275
QLI78709.1	1.42e-125	1	273	1	275

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1ZMB_A	9.30e-112	1	273	2	276	CrystalStructure of the Putative Acetylxylan Esterase from Clostridium acetobutylicum, Northeast Structural Genomics Target CaR6 [Clostridium acetobutylicum ATCC 824],1ZMB_B Crystal Structure of the Putative Acetylxylan Esterase from Clostridium acetobutylicum, Northeast Structural Genomics Target CaR6 [Clostridium acetobutylicum ATCC 824],1ZMB_C Crystal Structure of the Putative Acetylxylan Esterase from Clostridium acetobutylicum, Northeast Structural Genomics Target CaR6 [Clostridium acetobutylicum ATCC 824],1ZMB_D Crystal Structure of the Putative Acetylxylan Esterase from Clostridium acetobutylicum, Northeast Structural Genomics Target CaR6 [Clostridium acetobutylicum ATCC 824],1ZMB_E Crystal Structure of the Putative Acetylxylan Esterase from Clostridium acetobutylicum, Northeast Structural Genomics Target CaR6 [Clostridium acetobutylicum ATCC 824],1ZMB_F Crystal Structure of the Putative Acetylxylan Esterase from Clostridium acetobutylicum, Northeast Structural Genomics Target CaR6 [Clostridium acetobutylicum ATCC 824]
2APJ_A	3.52e-17	5	221	26	255	X-RayStructure of Protein from Arabidopsis Thaliana AT4G34215 at 1.6 Angstrom Resolution [Arabidopsis thaliana],2APJ_B X-Ray Structure of Protein from Arabidopsis Thaliana AT4G34215 at 1.6 Angstrom Resolution [Arabidopsis thaliana],2APJ_C X-Ray Structure of Protein from Arabidopsis Thaliana AT4G34215 at 1.6 Angstrom Resolution [Arabidopsis thaliana],2APJ_D X-Ray Structure of Protein from Arabidopsis Thaliana AT4G34215 at 1.6 Angstrom Resolution [Arabidopsis thaliana]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8L9J9	3.86e-17	5	221	26	255	Probable carbohydrate esterase At4g34215 OS=Arabidopsis thaliana OX=3702 GN=At4g34215 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000049	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001994_02449.