CAZyme Information: MGYG000001989_00219

Basic Information

• Species: CAG-269 sp900754285
• Lineage: Bacteria; Firmicutes_A; Clostridia; TANB77; CAG-508; CAG-269; CAG-269 sp900754285
• CAZyme ID: MGYG000001989_00219
• CAZy Family: GT51
• CAZyme Description: Monofunctional biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
232	MGYG000001989_3|CGC1	26651.66	8.5423

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001989	1569576	MAG	Spain	Europe

• Gene Location: Start: 49140; End: 49838 Strand: -

Full Sequence      

MKFFKKLILTLLILIIVLISILFIIGYSTYASALKQKPLVDRVTEVTSKENFVKFSKMSD
IYRNAVVAVEDHRFYDHGPVDFIAICRAFYINLKTKELQEGGSTITQQVAKNIVFSQEQS
WTRKLGEIFAAYDLEKNYTKNQIFEIYVNTAYFGDGFYGIYDASHGYYDKDPKDLNLDES
SMLAGVPNAPSLYSPNVNLTLAKKRQAHVIKKMQEYGYITQEQALPFLSYSY

Enzyme Prediction     

No EC number prediction in MGYG000001989_00219.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	47	214	1.1e-61	0.943502824858757

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00912	Transgly	1.97e-80	53	214	16	177	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
TIGR02074	PBP_1a_fam	5.65e-74	52	224	4	176	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	1.19e-70	52	224	78	251	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
COG5009	MrcA	1.14e-62	52	224	69	241	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
PRK13481	PRK13481	5.98e-42	40	223	35	224	glycosyltransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADL05597.1	6.21e-69	26	224	10	208
QUO38940.1	1.00e-68	20	228	24	232
QRP41835.1	1.26e-67	26	225	29	228
ASN93505.1	1.26e-67	26	225	29	228
QRV21928.1	3.94e-67	30	224	2	196

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3NB6_A	2.14e-39	49	223	19	193	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
2OQO_A	3.02e-39	49	223	19	193	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
4OON_A	8.08e-36	53	222	42	211	Crystalstructure of PBP1a in complex with compound 17 ((4Z,8S,11E,14S)-5-(2-amino-1,3-thiazol-4-yl)-14-(5,6-dihydroxy-1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)-8-formyl-2-methyl-6-oxo-3,10-dioxa-4,7,11-triazatetradeca-4,11-diene-2,12,14-tricarboxylic acid) [Pseudomonas aeruginosa PAO1]
5ZZK_A	6.50e-33	34	223	41	236	ChainA, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50]
3VMQ_A	9.70e-33	34	223	58	253	ChainA, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50],3VMQ_B Chain B, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50],3VMR_A Chain A, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50],3VMS_A Chain A, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50],3VMS_B Chain B, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50],3VMT_A Chain A, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50],3VMT_B Chain B, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q07259	8.91e-43	32	221	29	217	Putative transglycosylase H16_A0665 OS=Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337) OX=381666 GN=H16_A0665 PE=3 SV=2
O87626	9.43e-41	49	223	67	241	Penicillin-binding protein 1A OS=Neisseria flavescens OX=484 GN=mrcA PE=3 SV=1
O87579	2.41e-40	49	223	67	241	Penicillin-binding protein 1A OS=Neisseria lactamica OX=486 GN=mrcA PE=3 SV=1
P0A0Z6	1.57e-39	49	223	67	241	Penicillin-binding protein 1A OS=Neisseria meningitidis serogroup B (strain MC58) OX=122586 GN=mrcA PE=3 SV=1
P0A0Z5	1.57e-39	49	223	67	241	Penicillin-binding protein 1A OS=Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491) OX=122587 GN=mrcA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.966942	0.011073	0.009731	0.000084	0.000043	0.012165

TMHMM  Annotations     

start	end
7	29