CAZyme Information: MGYG000001979_00176

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; Acutalibacter
• CAZyme ID: MGYG000001979_00176
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase BoGH2A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
402		44633.38	4.7433

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001979	1528030	MAG	Spain	Europe

• Gene Location: Start: 2603; End: 3811 Strand: -

Full Sequence      

MAERLRQQDESRYIVNALNAFLSVMPWIKEGLEGKLGAEINETLSQLGDSMEAYMDLELV
TQHTKENLDVLDVSGYNYATGRYQLDGELFPNRVLMGSETFPKRIARNWREIQKYPHAIG
DFTWTGWDYLGEAGLGKMEYLQDGGDTVLAGSYPWRIGWCGDLDILGHRRPVSFYREIVF
GLRKEPYLAVEPPSKYGKTLAFDSLWNFIDGESSWTWPGWEGKPCRVHVFGDGDRFQLFA
NGEKLAQGELQEFRGSADLPYTPGTLEVLVFQGETLQGKHSLQTAVGPVSLQVEADKTVL
SADSRDLAFLEICLVDAKGVVNTAVSKEVEVKVTGAGYLAGMGSADPKSEESYLSPRHRF
FGGCALAVIRPKGEGTIQAEISAEGCATQTLRLQAVHPESLR

Enzyme Prediction     

EC	3.2.1.-

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam18565	Glyco_hydro2_C5	9.46e-32	291	392	1	103	Glycoside hydrolase family 2 C-terminal domain 5. Domain 5 is found in dimeric beta-D-galactosidase from Paracoccus sp. 32d, which contributes to stabilization of the functional dimer. It is suggested that the location of this domain 5, may be one of the factors responsible for the creation of a functional dimer and cold-adaptation of this enzyme.
pfam16355	DUF4982	3.69e-06	222	268	1	50	Domain of unknown function (DUF4982). This family is found in the C-terminal of uncharacterized proteins and beta-galactosidases around 680 residues in length from various Bacteroides species. The function of this protein is unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIQ31489.1	5.01e-122	1	395	407	803
CQR57812.1	4.21e-121	1	396	407	808
APO47637.1	2.17e-120	1	394	407	802
AET61101.1	1.41e-118	1	396	412	808
QZN73691.1	6.45e-116	1	396	411	818

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7RSK_A	1.46e-51	23	391	396	775	ChainA, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7RSK_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838]
6B6L_A	1.95e-51	23	391	396	775	Thecrystal structure of glycosyl hydrolase family 2 (GH2) member from Bacteroides cellulosilyticus DSM 14838 [Bacteroides cellulosilyticus DSM 14838],6B6L_B The crystal structure of glycosyl hydrolase family 2 (GH2) member from Bacteroides cellulosilyticus DSM 14838 [Bacteroides cellulosilyticus DSM 14838]
4YPJ_A	3.97e-26	23	398	425	810	ChainA, Beta galactosidase [Niallia circulans],4YPJ_B Chain B, Beta galactosidase [Niallia circulans]
7CWD_A	5.36e-26	23	388	419	794	ChainA, beta-glalactosidase [Niallia circulans],7CWI_A Chain A, beta-galactosidase [Niallia circulans]
5T98_A	5.38e-20	71	388	466	813	Crystalstructure of BuGH2Awt [Bacteroides uniformis],5T98_B Crystal structure of BuGH2Awt [Bacteroides uniformis],5T99_A Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis],5T99_B Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7LXS9	4.19e-17	70	395	515	848	Beta-galactosidase BoGH2A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02645 PE=1 SV=1
T2KM09	3.42e-07	109	308	563	741	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22050 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000028	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001979_00176.