CAZyme Information: MGYG000001977_02937

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides
• CAZyme ID: MGYG000001977_02937
• CAZy Family: GH3
• CAZyme Description: Beta-glucosidase BoGH3A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
737		80754.39	6.5072

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001977	4322077	MAG	Denmark	Europe

• Gene Location: Start: 5527; End: 7740 Strand: +

Full Sequence      

MKNKFFVTLLLACSISTVSAQTPAYMDDAQPIEVRVKDALGRMTLEEKVALCHAQGKFSS
AGVPRLGIPELWMSDGPHGVRAEINWNDWGYANWTNDSITAFPALTCLAATWNPEMSAKY
GKAVGEEARYREKDVLLGPGVNIYRTPMNGRNFEYMGEDPYLASVMCVPYIQELQKNGVA
ACVKHYALNNQELWRGHIDVNLSDRALYEIYLPAFKAAVEKGGAWSIMGAYNKIRGQHAC
HNDFTLNKILKDDWKFDGCVITDWGGAHDTYEAAINGLDIEMGSYTNGLTSESVFTYNDY
YLANPYLKMLKEGKVPMSTIDDKASRILRLIFRTAMNRQKPYGSVATEEHYAAAREIGNE
GIVLLKNAPVVKKGAPLLPIVADKYQNILVVGDNAVRLLNQGGGSSELKVKDMVSPLDGL
RAVYGDKVSYAKGYAAGRPMYGRADEIPQHVVDSLRAEAVEMAKKADLVVLVGGLNKNHF
QDCEGGDRQEYGLPFGQDELIEGMLGVNKNLVLVLLSGNAVEMPWIAQVPAIVQGWYLGS
MGGKSLADILSGAVNPSGKLPFSFPAKLTDCGAHAFDELGYPGDSIKEVYKEDILVGYRW
HDTKKIPALFSFGHGLSYTTFTYGKPVASAKTMAADGTLTVTVAVKNTGSVAGKEIVQLY
VGDDKCSVLRPVKELKHFAKVALAPGEEKNVTFTLTPDDLKFYDEASAAWKYEPGKFKAY
VCASSADVRGVVPFEMK

Enzyme Prediction     

EC	3.2.1.21

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	61	282	3.6e-65	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	5.79e-111	1	729	1	758	beta-glucosidase BglX.
PLN03080	PLN03080	7.70e-70	5	697	9	744	Probable beta-xylosidase; Provisional
COG1472	BglX	4.79e-67	64	432	56	395	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam01915	Glyco_hydro_3_C	3.97e-56	362	618	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
pfam00933	Glyco_hydro_3	4.33e-35	65	330	63	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT61320.1	0.0	1	737	1	737
QQA29800.1	0.0	1	737	1	737
BBK86688.1	0.0	1	737	1	737
AGU13700.1	0.0	1	737	1	737
QUU01449.1	0.0	1	737	1	737

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MS2_A	9.86e-152	34	728	3	660	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	4.43e-121	43	731	12	658	CrystalStructure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	6.05e-110	35	729	3	706	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
2X42_A	9.01e-109	35	729	3	706	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]
4I3G_A	1.13e-108	16	730	33	822	CrystalStructure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae],4I3G_B Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7LXS8	0.0	14	735	24	744	Beta-glucosidase BoGH3A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02644 PE=1 SV=1
P14002	5.40e-151	34	728	3	660	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2
P27034	2.22e-135	36	736	2	810	Beta-glucosidase OS=Rhizobium radiobacter OX=358 GN=cbg-1 PE=3 SV=1
E7CY69	7.84e-120	43	732	12	668	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium longum OX=216816 GN=apy PE=1 SV=1
F6C6C1	1.10e-119	43	732	12	668	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium breve (strain ACS-071-V-Sch8b) OX=866777 GN=HMPREF9228_1477 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000422	0.993764	0.005154	0.000244	0.000214	0.000190

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001977_02937.