CAZyme Information: MGYG000001977_02076

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides
• CAZyme ID: MGYG000001977_02076
• CAZy Family: GT2
• CAZyme Description: PGL/p-HBAD biosynthesis glycosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
248		28568.74	7.1403

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001977	4322077	MAG	Denmark	Europe

• Gene Location: Start: 1213; End: 1959 Strand: +

Full Sequence      

MHNHLTPKFSVITVTYNAEAVLEDTIQSVISQTYHHVEYIIVDGASKDGTLAIIDRYKDR
ITRIVSEPDKGLYDAMNKGIRLATGDYLCFLNAGDSFHEDDTLLQMVHSISGSELPDVLY
GETELVDKEGHFIRMRRLAAPETLTWRSFKQGMLVCHQAFFAKASLVEPYDLQYRFSADF
DWCIRVMKKARTLHNAHLTIIDYLEEGMTTQNRQASLRERFRIMVRHYGLVSTVAHHAWF
VLRAVIKK

Enzyme Prediction     

No EC number prediction in MGYG000001977_02076.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	10	151	8.2e-27	0.8705882352941177

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06433	GT_2_WfgS_like	4.45e-84	10	212	1	202	WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
PRK10063	PRK10063	9.85e-29	7	212	1	204	colanic acid biosynthesis glycosyltransferase WcaE.
cd00761	Glyco_tranf_GTA_type	4.95e-28	11	157	1	155	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
pfam00535	Glycos_transf_2	6.71e-28	10	162	1	158	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
COG0463	WcaA	4.97e-22	6	139	2	136	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBK86221.1	2.80e-174	1	248	1	248
QUT37659.1	2.80e-174	1	248	1	248
QBJ18283.1	1.14e-173	1	248	1	248
QPH58573.1	1.14e-173	1	248	1	248
QMI79738.1	1.14e-173	1	248	1	248

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3BCV_A	5.39e-11	5	100	3	100	Crystalstructure of a putative glycosyltransferase from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3BCV_B Crystal structure of a putative glycosyltransferase from Bacteroides fragilis [Bacteroides fragilis NCTC 9343]
5TZE_C	3.09e-09	8	123	2	136	Crystalstructure of S. aureus TarS in complex with UDP-GlcNAc [Staphylococcus aureus],5TZE_E Crystal structure of S. aureus TarS in complex with UDP-GlcNAc [Staphylococcus aureus],5TZI_C Crystal structure of S. aureus TarS 1-349 [Staphylococcus aureus],5TZJ_A Crystal structure of S. aureus TarS 1-349 in complex with UDP-GlcNAc [Staphylococcus aureus],5TZJ_C Crystal structure of S. aureus TarS 1-349 in complex with UDP-GlcNAc [Staphylococcus aureus],5TZK_C Crystal structure of S. aureus TarS 1-349 in complex with UDP [Staphylococcus aureus]
5TZ8_A	3.90e-09	8	123	2	136	Crystalstructure of S. aureus TarS [Staphylococcus aureus],5TZ8_B Crystal structure of S. aureus TarS [Staphylococcus aureus],5TZ8_C Crystal structure of S. aureus TarS [Staphylococcus aureus]
1H7L_A	2.91e-08	7	148	1	152	dTDP-MAGNESIUMCOMPLEX OF SPSA FROM BACILLUS SUBTILIS [Bacillus subtilis],1H7Q_A dTDP-MANGANESE COMPLEX OF SPSA FROM BACILLUS SUBTILIS [Bacillus subtilis],1QG8_A Native (Magnesium-Containing) Spsa From Bacillus Subtilis [Bacillus subtilis],1QGQ_A Udp-manganese Complex Of Spsa From Bacillus Subtilis [Bacillus subtilis],1QGS_A Udp-Magnesium Complex Of Spsa From Bacillus Subtilis [Bacillus subtilis]
6P61_A	1.08e-07	7	222	13	218	Structureof a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_B Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_C Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_D Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A5U6W5	9.24e-28	7	207	4	203	PGL/p-HBAD biosynthesis glycosyltransferase MRA_2984 OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) OX=419947 GN=MRA_2984 PE=3 SV=2
P0A5A0	9.24e-28	7	207	4	203	PGL/p-HBAD biosynthesis glycosyltransferase Mb2981 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) OX=233413 GN=BQ2027_MB2981 PE=3 SV=1
P9WMX7	9.24e-28	7	207	4	203	PGL/p-HBAD biosynthesis glycosyltransferase Rv2957 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv2957 PE=1 SV=1
P9WMX6	9.24e-28	7	207	4	203	PGL/p-HBAD biosynthesis glycosyltransferase MT3031 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT3031 PE=3 SV=1
A1KMV1	9.24e-28	7	207	4	203	PGL/p-HBAD biosynthesis glycosyltransferase BCG_2978 OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) OX=410289 GN=BCG_2978 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000066	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001977_02076.