CAZyme Information: MGYG000001977_02026

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides
• CAZyme ID: MGYG000001977_02026
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1047	MGYG000001977_81|CGC1	119682.24	6.3594

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001977	4322077	MAG	Denmark	Europe

• Gene Location: Start: 14311; End: 17454 Strand: +

Full Sequence      

MKNKLYTFLLSSLFCASALADNEPWQNPQVNEMNREPMHAYFTPFTNEANALKQRSLPAD
VRFDVNPAAERRITLDGTWKFLFSKNNDLCPTDFHKPGYSTRKWSKIEVPGSWELQGFDA
PIYTDTRYPFPPNPPHVPADYNPVGAYIREFTVPAGWEGLDIFLDFEGVESAYYVWVNGE
LAGYAEDSRLPSHFNITKLLKKGSNKLAVKVFRYSDGSYLEGQDYWKYSGIERSVYLYAR
PQSRVKDFRMTAELINGYKDGELKLDVFLHQPKAGETVEVKVMDKDKVIYDRKKSIASAT
DTLFAHRQVFPDARPWNAETPNTYTLVVSTFDAQGKPLESFTHLFGFRTVEMTNGMQMIN
GQAVLFKGVNRHEHDPHKGRTITVGSMIHDIQLMKQFNLNGVRNCHYPNNYAWYELCTEF
GLYMVDEANIESHGMMFHKDETLANYPDWEVPFMQRMSRMITRDRNCSAIVTWSMGNESG
YGKHFETLYDYTKKTDPTRPVQYEGGGYKSKSDIYCPMYARIWRLHQHVNQRDARPLILC
EYAHAMGNSVGNFQDYWDLIYKYDQLQGGFIWDWVDQAFAIKDKNDRDIWAFGGDMGFVG
VVNDSNFCANGLVAADRTPHPHIYEVKKVLQYIHFEPLAFTSNKIKVTNWHDFIGLEGYT
LRWAVECDGKTVQSGETDFPEIAPRSSANIELPLKTLPADGKEYFLTLRAFTKHEAPLVP
KGHEVAIEQWELPSTPPVLTAQPVKGTLAVDRSNGALTVKGDNFRVAFSTQNGEMTELDY
NGKNLIKEGLQPNFWRPMTDNDIPSGQLIRCNTWRSAGRDAKLQDIEVTEAGQTATVTAT
YRMEAQDSDLQVLYKIRPDGKVQVTMHFTPGKKPLSEMPRLGMRMILPAEYEMMTWLGRG
PQETYADRKTGALIGLYNATVWEQFHPYVRAQETANHCDVRWVALRNAAGEGLLVVGEEP
LSVSAWSFPMEDIEYRPSQMERRHGGSILKKDMVWLNIDHKQMGVGGDNTWGAQVHPEYT
ITPHEWKYSFTLSPLAPTDDAAEQAHK

Enzyme Prediction     

EC	3.2.1.23

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	67	914	2.4e-220	0.9667553191489362

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09525	lacZ	0.0	25	1034	17	1026	beta-galactosidase.
PRK10340	ebgA	0.0	25	1046	4	1012	cryptic beta-D-galactosidase subunit alpha; Reviewed
COG3250	LacZ	2.54e-151	70	915	10	807	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
smart01038	Bgal_small_N	1.20e-114	760	1032	1	272	Beta galactosidase small chain. This domain comprises the small chain of dimeric beta-galactosidases EC:3.2.1.23. This domain is also found in single chain beta-galactosidase.
pfam02836	Glyco_hydro_2_C	3.82e-102	350	635	1	302	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQA30341.1	0.0	1	1047	1	1047
QUT61855.1	0.0	1	1047	1	1047
QUT33388.1	0.0	1	1047	1	1047
BBK86098.1	0.0	1	1047	1	1047
QUU00829.1	0.0	1	1047	1	1047

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6S6Z_A	6.74e-249	25	1032	4	979	Structureof beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_B Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_C Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_D Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_E Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_F Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_G Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_H Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8]
6SD0_A	6.95e-249	25	1032	5	980	Structureof beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_B Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_C Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_D Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8]
3DEC_A	6.86e-212	25	1035	7	997	ChainA, Beta-galactosidase [Bacteroides thetaiotaomicron VPI-5482]
3BGA_A	1.02e-210	25	1035	10	1001	Crystalstructure of beta-galactosidase from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482],3BGA_B Crystal structure of beta-galactosidase from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482]
3MUY_1	3.98e-192	25	1028	16	1016	Chain1, Beta-D-galactosidase [Escherichia coli K-12],3MUY_2 Chain 2, Beta-D-galactosidase [Escherichia coli K-12],3MUY_3 Chain 3, Beta-D-galactosidase [Escherichia coli K-12],3MUY_4 Chain 4, Beta-D-galactosidase [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q56307	3.80e-248	25	1032	5	980	Beta-galactosidase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=lacZ PE=1 SV=2
O52847	1.14e-245	14	1035	8	1034	Beta-galactosidase OS=Priestia megaterium (strain DSM 319 / IMG 1521) OX=592022 GN=bgaM PE=3 SV=1
A5F5U6	1.18e-216	22	1032	10	1016	Beta-galactosidase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) OX=345073 GN=lacZ PE=3 SV=2
A1SWB8	1.11e-213	25	1033	13	1033	Beta-galactosidase OS=Psychromonas ingrahamii (strain 37) OX=357804 GN=lacZ PE=3 SV=1
A4W7D2	2.51e-206	8	1031	2	1024	Beta-galactosidase OS=Enterobacter sp. (strain 638) OX=399742 GN=lacZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001668	0.762017	0.235241	0.000390	0.000339	0.000324

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001977_02026.