CAZyme Information: MGYG000001963_01972

Basic Information

• Species: Phocaeicola sp000434735
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp000434735
• CAZyme ID: MGYG000001963_01972
• CAZy Family: GT94
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
339	MGYG000001963_47|CGC1	38614.62	9.4279

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001963	3288738	MAG	Denmark	Europe

• Gene Location: Start: 192; End: 1211 Strand: -

Full Sequence      

MKRFVVFPNLTVSPAQRPNPYIQDYIEALNRLPDVRVINPAHKNPLLSLLPPSRWGDVFI
FNWFESIPDFKYGPLQAVTATAFLLLQRIRGKKIVWMLHNKKPHAQGRDGMKTFLARLIA
KNSSLIITHSEEGVRLVHNDFPYAAHKVHYIDHPTKCRLQLATAASTAEKKYDLLIWGTI
ARYKGIFEFVDYIRTNKIDHLRICIVGGASETVFKDLKAICPDNITLINQRPSFDELADY
INQSEFVLCPYAPETILSSGMLMDSLSFGAKVIGPEVGSFKDYASNSLLNVYTFKSFDDI
SGIAQRHKHDSVSLANYRKFLEENDWTHYAQKLAKLLGI

Enzyme Prediction     

No EC number prediction in MGYG000001963_01972.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT94	75	284	1.4e-18	0.7173144876325088

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03801	GT4_PimA-like	6.75e-10	21	337	19	365	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
cd03822	GT4_mannosyltransferase-like	8.40e-08	35	335	53	354	mannosyltransferases of glycosyltransferase family 4 and similar proteins. This family is most closely related to the GT1 family of glycosyltransferases. ORF704 in E. coli has been shown to be involved in the biosynthesis of O-specific mannose homopolysaccharides.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AHF12554.1	1.66e-122	1	337	1	336
QLK81295.1	1.91e-92	3	337	2	331
QCQ44050.1	1.91e-92	3	337	2	331
QCQ53011.1	1.91e-92	3	337	2	331
QRM69051.1	1.91e-92	3	337	2	331

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000044	0.000006	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001963_01972.