CAZyme Information: MGYG000001963_00079

Basic Information

• Species: Phocaeicola sp000434735
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp000434735
• CAZyme ID: MGYG000001963_00079
• CAZy Family: GH63
• CAZyme Description: Glucosidase YgjK

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
666	MGYG000001963_1|CGC3	75063.77	5.1446

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001963	3288738	MAG	Denmark	Europe

• Gene Location: Start: 101077; End: 103077 Strand: -

Full Sequence      

MLLNGAALLCLATACSPSSSESNEPLLSQQSDFYNLINVKNVPTQPRNPYVMLNLFADLG
SWSGYALPENESSDYAGAFIGPMAMTGRGWVSATMAQPFIQVNGNPYDLARNIQTSKYLP
GRLVQEFSDEQLQVKTELCFLSSRTVLVHSSVENCSNQPLTLSWTWKGGSFPETATWSFE
DHQATALRLKDSVRVATRFITAADVTPVGKDSLRVNEKSDFVLQPGESYTSNYTQTLMLR
NEDMQAELAKWQAPDAEQCLKQNAERWNGWLASLLNGKSKYLKDNMYRRVIVKAMMTLNS
NWRSAAGDILHAGSNPSYTGFLGGIWSWDSWKIASANALYNPEMAKDEMRTLFDHQAPNG
MVPDFIGYNRRYNNWRDTKPPVAGWGTMNVYRASGDKEFLAEMYPKLMKFHRWWYAERDH
DHNGICEYGSTDGTLIAAAWESGMDNGVRFDDAVMLQNGENAWSMNQENICLNSFLYADK
LALAEMAEILGKKDEAAQLKKEAEVVAEHVRTKMFDPETGFFYDTRLETGEFIKVMGAEC
WLPLWAGIATQEQAKAVMEKMMDTNKFNSTLPLGTLAVDHPRLRPVRGYWRGPVWVDQVY
FGITGLRKYGFNKEADFLTEKFIRNAQGLTTDGTINENYNPLTGEQLNAPNFGWSSATII
KMLLEN

Enzyme Prediction     

No EC number prediction in MGYG000001963_00079.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH63	199	663	2e-107	0.5631578947368421

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10137	PRK10137	2.47e-154	30	657	29	774	alpha-glucosidase; Provisional
COG3408	GDB1	2.33e-24	306	665	268	605	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
pfam01204	Trehalase	6.52e-17	381	663	222	505	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
COG1626	TreA	1.84e-11	470	663	354	549	Neutral trehalase [Carbohydrate transport and metabolism].
PLN02567	PLN02567	1.40e-09	357	663	191	541	alpha,alpha-trehalase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUU00825.1	0.0	10	665	16	668
QQA30345.1	0.0	10	665	16	668
QUT61859.1	0.0	10	665	16	668
BBK86094.1	0.0	10	665	16	668
ABR38022.1	1.94e-299	14	665	18	688

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W7S_A	3.10e-99	35	657	1	747	Escherichiacoli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7S_B Escherichia coli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7T_A Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7T_B Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7U_A Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12],3W7U_B Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12]
3W7X_A	1.66e-98	35	657	1	747	Crystalstructure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],3W7X_B Crystal structure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],5CA3_A Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5CA3_B Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
3W7W_A	2.32e-98	35	657	1	747	Crystalstructure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],3W7W_B Crystal structure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],5GW7_A Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5GW7_B Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
3D3I_A	7.67e-94	32	657	5	748	Crystalstructural of Escherichia coli K12 YgjK, a glucosidase belonging to glycoside hydrolase family 63 [Escherichia coli K-12],3D3I_B Crystal structural of Escherichia coli K12 YgjK, a glucosidase belonging to glycoside hydrolase family 63 [Escherichia coli K-12]
7PQQ_B	5.37e-48	436	657	41	296	ChainB, Anti-RON nanobody,Megabody 91,Glucosidase YgjK [Lama glama]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P42592	1.04e-98	26	657	15	770	Glucosidase YgjK OS=Escherichia coli (strain K12) OX=83333 GN=ygjK PE=1 SV=1
D8QTR2	4.70e-22	326	665	98	487	Mannosylglycerate hydrolase MGH1 OS=Selaginella moellendorffii OX=88036 GN=MGH PE=1 SV=1
D8T3S4	8.37e-22	326	666	98	488	Mannosylglycerate hydrolase MGH2 OS=Selaginella moellendorffii OX=88036 GN=SELMODRAFT_447962 PE=3 SV=1
K5BDL0	1.01e-12	325	663	39	445	Glucosylglycerate hydrolase OS=Mycolicibacterium hassiacum (strain DSM 44199 / CIP 105218 / JCM 12690 / 3849) OX=1122247 GN=ggh PE=1 SV=1
Q757L1	1.60e-08	452	644	456	667	Probable trehalase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=NTH2 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000046	0.014007	0.985952	0.000009	0.000014	0.000009

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001963_00079.