CAZyme Information: MGYG000001961_00663

Basic Information

• Species: Frisingicoccus sp900753685
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Frisingicoccus; Frisingicoccus sp900753685
• CAZyme ID: MGYG000001961_00663
• CAZy Family: GT4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
402	MGYG000001961_16|CGC1	47136.2	6.1021

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001961	2208468	MAG	Denmark	Europe

• Gene Location: Start: 27838; End: 29046 Strand: +

Full Sequence      

MKPKICFVVQRYGLEVNGGAELHCRQLAEHLLPYCDSVDVLTTKAIDYMTWKDEYPNDED
FIHGIRVLRFGVKAPRELSRFNVINQKVYDNKPMSPSEEQKWLDEQGPLVPDMIRYIKNH
KADYDVFIFFTYLYYQTVMGVPEVKDKAIVIPTAHDEPFLKMRIFERVFRFPKAFFFNTY
EERRLIHKKFYNHFVRDDLGGVGVEAPDNVSAQAFKEKYHIDNYVVYVGRIDEGKNCRQL
FEDFIRFKKKYPSDLKLVFMGKEVIKVPEHEDFISLGFVDDEDKFNGIAGAKALILPSKY
ESLSMVVLEAFSMNIPVLVNGECEVLKAHCTKSNAGFYYNNTEEFEEILNYMLSHEDILR
KMGICGHEYVEAYYCWDTIVSRLLRLIQYVIQDSASDMRKVQ

Enzyme Prediction     

No EC number prediction in MGYG000001961_00663.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03801	GT4_PimA-like	2.45e-24	4	388	1	366	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
COG0438	RfaB	2.63e-22	4	394	1	381	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd03809	GT4_MtfB-like	3.20e-17	102	384	39	361	glycosyltransferases MtfB, WbpX, and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. MtfB (mannosyltransferase B) in E. coli has been shown to direct the growth of the O9-specific polysaccharide chain. It transfers two mannoses into the position 3 of the previously synthesized polysaccharide.
cd03811	GT4_GT28_WabH-like	4.80e-17	115	374	77	350	family 4 and family 28 glycosyltransferases similar to Klebsiella WabH. This family is most closely related to the GT1 family of glycosyltransferases. WabH in Klebsiella pneumoniae has been shown to transfer a GlcNAc residue from UDP-GlcNAc onto the acceptor GalUA residue in the cellular outer core.
cd03808	GT4_CapM-like	6.89e-16	150	384	108	358	capsular polysaccharide biosynthesis glycosyltransferase CapM and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. CapM in Staphylococcus aureus is required for the synthesis of type 1 capsular polysaccharides.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AKB83469.1	1.20e-137	4	390	2	386
AAS55717.1	2.20e-137	1	391	1	392
AMA71698.1	2.20e-137	1	391	1	392
AKJ39142.1	4.11e-135	4	397	2	393
AKB58354.1	4.11e-135	4	397	2	393

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000064	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001961_00663.