CAZyme Information: MGYG000001956_00275

Basic Information

• Species: Eubacterium_R sp900543795
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; Eubacterium_R; Eubacterium_R sp900543795
• CAZyme ID: MGYG000001956_00275
• CAZy Family: GH3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
804	MGYG000001956_4|CGC1	88458.34	5.3124

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001956	1751837	MAG	Denmark	Europe

• Gene Location: Start: 6426; End: 8840 Strand: -

Full Sequence      

MSKLKETALKIYGGISSVAQKKIVNREEGGAVAPEVSALLRRAAAEGAVLLKNNSILPLK
KGSVVSLFGRVQNDWFYTGYGSGGDVNRQYEVNLADGIRACELLSLNEELAEVYSGWCEK
NKIAEAGWGMWPRFYPEMPISDIEVARAENKSDCAVVVIGRSSGEDRENALEKGSYYLTD
EERSLLKAVRSYFEKTVVVLNIGSVIDFSWVEELDIPAVLIAWQGGMESGNAVSDILCGR
INPCGKLTDTCAAEYSDYPSASCFGNAEYNYYKEDIYVGYRYFETFEKEKVLFPFGFGLS
YTEFEISLLESSAQENGFSFTAELKNTGSRAGKEVAQLYLGKPCAVLGNPEKELCAFVKT
KELQPNEAQKISFFVSLEQLASYDESGKAGFASSYVVEAGEYDFYLGNNVRSSEKIFSYY
QEETVCISTLSQCCAPKESFGVITALESNTRRLPIFRPCRANEVNLKKRILSNLPPELKK
SSNENITLADVKEGRASLDDFTAQLNAKELEAITRGDYSMNSPLGASGNAGAYAGVLPSL
REKGIPAVTTTDGPSGIRLSAGCMLIPIGTLLASSFDEELVFEVYSAVAQEMKSRGSDVL
LAPGMNIHRNVLCGRNFEYYSEDPYLTGKIGAAAVRGIQSQGGAACPKHFACNNQEFRRT
INDARVSERALRQIYLKGFEICIKEAEPKNIMTSYNKINGVWSYYNYDLCTSILRGEWGY
NGCVITDWWIKNGKSPDFPKIKAQAYRVRAQVDVLMPGGKRVGLKRPDGTLLSSLGKEGG
ITLGEIQRSAKNVIRLAMNSSAFK

Enzyme Prediction     

EC	3.2.1.21	3.2.1.58	3.2.1.37	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	542	757	2e-63	0.9722222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1472	BglX	2.95e-49	544	796	59	311	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam01915	Glyco_hydro_3_C	7.24e-40	48	280	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
PRK15098	PRK15098	1.46e-37	41	407	388	751	beta-glucosidase BglX.
pfam00933	Glyco_hydro_3	5.31e-27	512	796	34	316	Glycosyl hydrolase family 3 N terminal domain.
PLN03080	PLN03080	1.04e-17	534	727	73	297	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AZS42860.1	6.12e-275	15	798	19	806
CED90919.1	1.27e-265	34	802	28	808
ANC30255.1	1.55e-265	18	800	29	816
AQX17210.1	2.05e-265	15	795	5	793
QHO90712.1	2.81e-265	34	802	29	811

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5WUG_A	8.76e-215	41	802	41	824	Expression,characterization and crystal structure of a novel beta-glucosidase from Paenibacillus barengoltzii [Paenibacillus barengoltzii],5WVP_A Expression, characterization and crystal structure of a novel beta-glucosidase from Paenibacillus barengoltzii [Paenibacillus barengoltzii]
2X42_A	7.30e-68	43	412	331	704	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]
2X40_A	7.30e-68	43	412	331	704	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
7MS2_A	4.25e-47	540	734	32	238	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	2.08e-44	526	728	18	233	CrystalStructure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P15885	4.11e-201	45	802	18	767	Beta-glucosidase OS=Ruminococcus albus OX=1264 PE=3 SV=1
P16084	4.59e-137	43	729	35	771	Beta-glucosidase A OS=Butyrivibrio fibrisolvens OX=831 GN=bglA PE=3 SV=1
Q5BFG8	2.20e-48	542	804	40	293	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1
P14002	2.33e-46	540	734	32	238	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2
E7CY69	2.55e-45	526	728	18	233	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium longum OX=216816 GN=apy PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000053	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001956_00275.