CAZyme Information: MGYG000001954_01134

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Enterocloster
• CAZyme ID: MGYG000001954_01134
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
371	MGYG000001954_25|CGC1	43658.55	7.8429

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001954	3305855	MAG	Denmark	Europe

• Gene Location: Start: 23698; End: 24813 Strand: -

Full Sequence      

MEEKKAARESGRPETAGPSLAAAAWRQAVQDARAEEERMCRQETDGAKGERPLVSICCIT
YNHGPYIRQTLEGFLMQETDFSWEILIHDDASTDDTQDIIREYAARFPDRIRPILREENQ
YSRGISNISIFNFPRVRGKYIAMCEGDDCWTDPNKLQLQVDYLRAHPDCALCFHSARIVT
VDGSVAAGRMRPYRGDRRVEPEEIVDKTSGYPTASLVFPAEIMKELPDYYLDCPVGDIPM
QLMMAQRGYGWYMDRDMSIYRVGVASSWTSLMKQGDYEKKQRRYYEEMKRMYQAFDRESK
GRFHRQAVRAARRIYFLTQVNTKHYDQVMAPEYREFYRELDFRTRFFIRFEILAPGLYRW
LQRRVRKSEGV

Enzyme Prediction     

No EC number prediction in MGYG000001954_01134.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	55	182	8.6e-19	0.7235294117647059

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04196	GT_2_like_d	1.41e-25	55	240	1	177	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
cd00761	Glyco_tranf_GTA_type	3.27e-20	60	179	5	118	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
pfam00535	Glycos_transf_2	3.89e-18	55	172	1	112	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
COG0463	WcaA	1.08e-13	50	360	1	291	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd04184	GT2_RfbC_Mx_like	5.95e-13	52	171	1	116	Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRV19558.1	9.47e-135	46	370	3	328
ADL06344.1	9.47e-135	46	370	3	328
SET96522.1	7.23e-132	46	363	3	321
QJU21876.1	1.22e-129	53	358	19	325
QQQ98687.1	1.22e-129	53	358	19	325

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P64864	1.62e-32	54	184	1	128	Uncharacterized protein Mb1547 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) OX=233413 GN=BQ2027_MB1547 PE=4 SV=1
P9WLV4	1.62e-32	54	184	1	128	Uncharacterized protein MT1570 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT1570 PE=4 SV=1
P9WLV5	1.62e-32	54	184	1	128	Uncharacterized protein Rv1520 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv1520 PE=1 SV=1
O32268	9.58e-13	51	184	5	131	Putative teichuronic acid biosynthesis glycosyltransferase TuaG OS=Bacillus subtilis (strain 168) OX=224308 GN=tuaG PE=2 SV=1
P71054	2.32e-09	52	166	5	114	Putative glycosyltransferase EpsE OS=Bacillus subtilis (strain 168) OX=224308 GN=epsE PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000041	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001954_01134.