CAZyme Information: MGYG000001951_01894

Basic Information

• Species: CAG-873 sp900548975
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-873; CAG-873 sp900548975
• CAZyme ID: MGYG000001951_01894
• CAZy Family: GH127
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
675	MGYG000001951_24|CGC1	76506.03	4.913

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001951	2929441	MAG	Denmark	Europe

• Gene Location: Start: 25705; End: 27732 Strand: -

Full Sequence      

MTNFNRFLAVAACAIAATAMQGRTPSDAAAYANNRYPLMTKPYIELPLGSVRPQGWLREM
LTRQRDGASGKMDILYPEVMGPRNGWLGGDGDQWERGPYWIDGLVPLAYILDDEQLKEKA
RPWIEWALASQREDGYFGPDRDYAPEAGLQRDNAADWWPRMVVLKILQQYYSATADTRVI
DFMTRYFHYQLATLPSCPLGKWTFWAEYRAGDNLQAVYWLYNITGDRSLLDLAELLHSQS
VDFTGMFTGTDMLSRFNTIHCVNLAQGLKEPVIYYQQSHDRRHVDAVKKGLRDIATYNGQ
PQGMYGDEGLHGNVPTQGSELCSAVELMYSLEKMTEITGDIDFVDHLERIAFNALPTQVT
DDFMNKQYFQQANQVSATRDPHNFYEDHNHGHTDIVFGSRTGYPCCFSNMHQGWPKFTAS
LWYATPDNGLAALAYSPSEVTAKVGNGRTVTITEDTFYPMDGEINFTVSFKDTKRPGEFP
LHLRVPGWCDNPAVSINGTAADITVRDGVIVLAREWRHGDRVTLTLPMSVRVSRWYENSA
AIERGPLVYALRMEENWNKTELQADDAVQFGPYFYEVTSPTKWNYGITESTLADPANFEV
SVDSEKMKSPYPWNIGSAPIEIKVKAREVKEWSLYNNMAGPMPNSNTRSDAPEEEITLIP
YGCTTLRISEFPVLR

Enzyme Prediction     

No EC number prediction in MGYG000001951_01894.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH127	319	550	2.1e-36	0.4255725190839695

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	2.33e-63	99	550	62	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	1.81e-33	113	551	84	502	Uncharacterized conserved protein, DUF1680 family [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATP55412.1	9.91e-159	31	674	28	651
ALL07583.1	3.31e-156	29	674	26	651
QNN43859.1	1.70e-155	34	674	29	649
QHS59113.1	1.37e-154	23	674	24	651
AMP98056.1	2.04e-154	31	674	28	651

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4QJY_A	1.96e-23	100	556	82	566	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	1.77e-21	41	556	24	566	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
6EX6_A	4.19e-17	101	611	76	608	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]
5MQO_A	1.41e-13	316	551	377	608	Glycosidehydrolase BT_1003 [Bacteroides thetaiotaomicron]
3WRE_A	8.55e-12	316	558	334	578	Thecrystal structure of native HypBA1 from Bifidobacterium longum JCM 1217 [Bifidobacterium longum subsp. longum JCM 1217],3WRG_A The complex structure of HypBA1 with L-arabinose [Bifidobacterium longum subsp. longum JCM 1217]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
E8MGH8	4.68e-11	316	558	334	578	Non-reducing end beta-L-arabinofuranosidase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=hypBA1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.069164	0.874530	0.054830	0.000782	0.000354	0.000305

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001951_01894.