CAZyme Information: MGYG000001951_00443

Basic Information

• Species: CAG-873 sp900548975
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-873; CAG-873 sp900548975
• CAZyme ID: MGYG000001951_00443
• CAZy Family: GH3
• CAZyme Description: Beta-hexosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
864	MGYG000001951_3|CGC1	95826.76	5.0849

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001951	2929441	MAG	Denmark	Europe

• Gene Location: Start: 92736; End: 95330 Strand: +

Full Sequence      

MTLNMRVKIIPALILCLASPGVWADDVLPYKNPALPTEVRVDDLLGRMTLEEKIAQMSHI
HSWQIYDDQTLDYTKLTEKCRDLPYGFFEGFPLTAENLKKNFRQVQKYLLEETRLGIPAF
PCGESLHGVIQEGCTVYPQTIAVGSTFNTELAREMTKYISGELNTLGVKQVFAPCMDVVR
EIRWGRTEESFGEDPWLCSVMSLAQVQGYIDGGTSPMLKHYGPHGKPNSGLNIASVECGT
RDLFDIYLKPFEYVVENAPVMAVMSSYNSWNHVPNSASHFLLTDVLRGKFGFRGYVYTDW
GTLNMLKNVHRTAETNFDAAYQGLTAGIDAEASSNTFSTLQENILQGNIDEKYVDQAVRR
ILRAKIETGLMDDPYLEHCAFYLPVGSSQGAELSRRIADESAVLLKNENNLLPLDIESVK
KIAVIGPNAACVQFGDYSWSKNPDDGVTPLEGIRKLVGDRAEVQYAKGCSLSSLDTSGIE
EAVNLAAQSDVALLFVGSSSTVFVRESGASTSGEGVDLCEIELTGAQEELVRRVTSTGTP
VVLVLVSGKPFAMPWAAENVPAILVQWYCGEREGDSIADIIFGNVNPSGKLNFSFPRSTG
QLPVYYNYLPSDKGYYKRPGSYEQPGRDYVFSTPMPQWSFGHGLSYTDFDYISAQTDKES
YAPFDTIRVTAAIKNIGKRAGKEVMQVYVRDVVSTVVTPIRQLKGFQKKEVAPGATEIFT
VNIPVKELYLTDENGNRYLEAGKFEIQVGTSSADIKHIIPVWVGGQKMPDSPEKTAALQK
KTSLKKNMTMRKISGCVRDIQATPIEGVEVSSDMTDTKVYTDRKDNYSIEVPAESNLTFL
KTGYSRYSKYIKDSNTVNVQIVRE

Enzyme Prediction     

No EC number prediction in MGYG000001951_00443.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	111	331	1.7e-59	0.9768518518518519

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	4.54e-140	12	757	8	759	beta-glucosidase BglX.
COG1472	BglX	9.77e-86	48	471	1	397	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam01915	Glyco_hydro_3_C	8.20e-71	402	646	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
PLN03080	PLN03080	2.27e-69	29	761	41	777	Probable beta-xylosidase; Provisional
pfam00933	Glyco_hydro_3	6.30e-55	49	364	1	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASW16389.1	0.0	24	863	21	857
QQT79218.1	0.0	24	863	21	857
QUT25566.1	0.0	24	863	21	857
QRP58898.1	0.0	24	863	21	857
BCA51778.1	0.0	24	863	21	857

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5YOT_A	1.51e-153	25	756	2	749	Isoprimeverose-producingenzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YOT_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_A Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40]
7EAP_A	1.18e-152	25	756	2	749	ChainA, Fn3_like domain-containing protein [Aspergillus oryzae RIB40]
5Z87_A	5.55e-131	17	756	26	778	ChainA, EmGH1 [Aurantiacibacter marinus],5Z87_B Chain B, EmGH1 [Aurantiacibacter marinus]
5XXL_A	1.80e-109	41	756	14	745	Crystalstructure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]
5XXN_A	9.60e-109	41	756	14	745	CrystalStructure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXN_B Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXO_A Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482],5XXO_B Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KMH0	4.45e-134	114	752	62	710	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
T2KMH9	2.06e-112	30	756	29	748	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1
P33363	3.59e-103	17	756	13	758	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
Q56078	9.75e-103	30	756	24	758	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
Q23892	3.11e-83	41	749	80	812	Lysosomal beta glucosidase OS=Dictyostelium discoideum OX=44689 GN=gluA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000277	0.999036	0.000202	0.000153	0.000150	0.000139

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001951_00443.