CAZyme Information: MGYG000001951_00263

Basic Information

• Species: CAG-873 sp900548975
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-873; CAG-873 sp900548975
• CAZyme ID: MGYG000001951_00263
• CAZy Family: GH25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
327	MGYG000001951_2|CGC1	37338.94	9.8884

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001951	2929441	MAG	Denmark	Europe

• Gene Location: Start: 94035; End: 95018 Strand: -

Full Sequence      

MKHSVLFHIRFYIILAALLQSFGPAWGAEGELRTSRYVYTGGVADGKQHGFGICRYTNDD
IYTGYWNMGYKEGLGRMEFANGTMDFGRWRQGILNKPKGRKFKPGKRCYGIDVAKYQGKV
DWTALSLPARADGTISASGKNAPYLQPVLFALIKSTEGVTIKDPYFDRNFAAAKAAGIIR
GAYHFLSVNSPVEEQVQFFIDNTPLEKGDLPPVLDLEISKKTMQQQHEKVCRMALEWLKA
IEKHYGVKPIIYTYENYYKDYLKGHGFDKYDFWIARYGAEPSARKWEIWQLTDKGTVSGI
GHKVDIDLFRGSYKDLKKYLKKKGIQK

Enzyme Prediction     

No EC number prediction in MGYG000001951_00263.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH25	111	300	2.9e-48	0.9943502824858758

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06524	GH25_YegX-like	2.43e-70	109	311	1	194	YegX is an uncharacterized bacterial protein with a glycosyl hydrolase family 25 (GH25) catalytic domain that is similar in sequence to the CH-type (Chalaropsis-type) lysozymes of the GH25 family of endolysins.
cd06413	GH25_muramidase_1	7.04e-59	110	311	5	191	Uncharacterized bacterial muramidase containing a glycosyl hydrolase family 25 (GH25) catalytic domain. Endo-N-acetylmuramidases are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues.
cd00599	GH25_muramidase	2.42e-54	109	309	1	186	Endo-N-acetylmuramidases (muramidases) are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. This family of muramidases contains a glycosyl hydrolase family 25 (GH25) catalytic domain and is found in bacteria, fungi, slime molds, round worms, protozoans and bacteriophages. The bacteriophage members are referred to as endolysins which are involved in lysing the host cell at the end of the replication cycle to allow release of mature phage particles. Endolysins are typically modular enzymes consisting of a catalytically active domain that hydrolyzes the peptidoglycan cell wall and a cell wall-binding domain that anchors the protein to the cell wall. Endolysins generally have narrow substrate specificities with either intra-species or intra-genus bacteriolytic activity.
COG3757	Acm	2.77e-43	110	312	65	256	Lyzozyme M1 (1,4-beta-N-acetylmuramidase), GH25 family [Cell wall/membrane/envelope biogenesis].
pfam01183	Glyco_hydro_25	2.93e-43	111	300	1	180	Glycosyl hydrolases family 25.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ARS37092.1	2.03e-49	110	316	57	246
AMS28070.1	4.54e-47	109	322	34	235
QVJ81269.1	9.27e-47	102	317	78	281
ADE83319.1	9.52e-47	102	317	79	282
EFC71412.1	1.05e-46	101	318	63	267

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2WAG_A	1.76e-34	110	319	18	216	TheStructure of a family 25 Glycosyl hydrolase from Bacillus anthracis. [Bacillus anthracis str. Ames]
1JFX_A	1.33e-16	110	312	7	205	Crystalstructure of the bacterial lysozyme from Streptomyces coelicolor at 1.65 A resolution [Streptomyces coelicolor]
5A6S_A	4.27e-14	152	305	48	197	Crystalstructure of the CTP1L endolysin reveals how its activity is regulated by a secondary translation product [Clostridium phage phiCTP1]
2X8R_A	1.09e-12	110	318	6	206	Thestructure of a family GH25 lysozyme from Aspergillus fumigatus [Aspergillus fumigatus Af293],2X8R_B The structure of a family GH25 lysozyme from Aspergillus fumigatus [Aspergillus fumigatus Af293],2X8R_C The structure of a family GH25 lysozyme from Aspergillus fumigatus [Aspergillus fumigatus Af293],2X8R_D The structure of a family GH25 lysozyme from Aspergillus fumigatus [Aspergillus fumigatus Af293],2X8R_E The structure of a family GH25 lysozyme from Aspergillus fumigatus [Aspergillus fumigatus Af293],2X8R_F The structure of a family GH25 lysozyme from Aspergillus fumigatus [Aspergillus fumigatus Af293]
6ZMV_A	1.46e-10	110	317	4	201	ChainA, muramidase [Trichobolus zukalii],6ZMV_B Chain B, muramidase [Trichobolus zukalii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P76421	2.27e-35	109	320	68	265	Uncharacterized protein YegX OS=Escherichia coli (strain K12) OX=83333 GN=yegX PE=3 SV=2
Q8FFY2	2.27e-35	109	320	68	265	Uncharacterized protein YegX OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=yegX PE=3 SV=2
Q8X7H0	4.44e-35	109	320	68	265	Uncharacterized protein YegX OS=Escherichia coli O157:H7 OX=83334 GN=yegX PE=3 SV=2
P26836	7.79e-18	110	321	11	208	Probable autolytic lysozyme OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=lyc PE=3 SV=2
P25310	2.30e-15	110	312	84	282	Lysozyme M1 OS=Streptomyces globisporus OX=1908 GN=acm PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000256	0.999112	0.000185	0.000164	0.000146	0.000137

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001951_00263.