CAZyme Information: MGYG000001948_00046

Basic Information

• Species: Muribaculum sp002492595
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; Muribaculum; Muribaculum sp002492595
• CAZyme ID: MGYG000001948_00046
• CAZy Family: GT92
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
314	MGYG000001948_1|CGC2	37746.63	8.6428

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001948	2811075	MAG	Denmark	Europe

• Gene Location: Start: 59772; End: 60716 Strand: +

Full Sequence      

MNKTMKIAIKRHIITPTVNMFYRSMFAMRRPCINSDARYMFAICAIFRNEARYMREWIEY
HLLIGVDHIFLYNNFSTDDFMPILQPYIEKGVVTLTEWPHEHGQMECYMHCSANFGKSCR
WIAFIDLDEYICPHEATDIKEWIKRYEKYPGVILYWLMFGTAGRLHPDPEKTLIEQYTTS
WQEFRNTGKPIWNTAFPLEELFVHYLYGSVSIFGIKFKVPMVNESGSFVMYPDHHPLPRH
NTIRINHYWSKSIEEYHDKMARGSAFSAKKNEIRRKVDFFLWHEHHAVRDDRVIFRFLTQ
LKMRLNGTDFNLHK

Enzyme Prediction     

No EC number prediction in MGYG000001948_00046.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT92	42	149	1.2e-18	0.43010752688172044

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01697	Glyco_transf_92	9.87e-17	53	191	19	174	Glycosyltransferase family 92. Members of this family act as galactosyltransferases, belonging to glycosyltransferase family 92. The aligned region contains several conserved cysteine residues and several charged residues that may be catalytic residues. This is supported by the inclusion of this family in the GT-A glycosyl transferase superfamily.
pfam13704	Glyco_tranf_2_4	1.67e-11	48	143	1	97	Glycosyl transferase family 2. Members of this family of prokaryotic proteins include putative glucosyltransferases,

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCD36439.1	8.76e-236	1	314	1	314
QUT45116.1	1.39e-77	26	305	24	312
QRQ50340.1	2.57e-77	28	305	8	287
QCQ54731.1	1.57e-76	2	305	13	321
AWK07245.1	7.95e-74	35	308	64	345

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q6YRM6	1.54e-15	43	178	318	456	Glycosyltransferase family 92 protein Os08g0121900 OS=Oryza sativa subsp. japonica OX=39947 GN=Os08g0121900 PE=2 SV=1
B9SLR1	3.61e-15	31	144	271	385	Glycosyltransferase family 92 protein RCOM_0530710 OS=Ricinus communis OX=3988 GN=RCOM_0530710 PE=3 SV=1
B9S2H4	3.25e-12	34	139	290	398	Glycosyltransferase family 92 protein RCOM_0530710 OS=Ricinus communis OX=3988 GN=RCOM_0699480 PE=3 SV=1
Q94K98	6.03e-11	35	130	287	383	Glycosyltransferase family 92 protein At1g27200 OS=Arabidopsis thaliana OX=3702 GN=At1g27200 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000047	0.000006	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001948_00046.