CAZyme Information: MGYG000001933_00430

Basic Information

• Species: Prevotella sp900544495
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900544495
• CAZyme ID: MGYG000001933_00430
• CAZy Family: GT51
• CAZyme Description: Biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
247	MGYG000001933_5|CGC1	27781.02	10.18

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001933	2797127	MAG	Denmark	Europe

• Gene Location: Start: 72135; End: 72878 Strand: -

Full Sequence      

MKFGIISKVVRWAAALFFGSTILAVVAYRFLPVYVTPLMVIRCVQQVGEGKSITLHHSWK
SLDEISCHLPVAVMASEDQRFLIHHGFDFGAIQKAARNNARGAGRKLGASTISQQTAKNV
FLWPGRSWTRKGFEVYFTALIEMLWSKQRIMEVYLNSIEMGDGIYGAEAVAKYHFGKAAS
ELTRSECALVAATLPNPRKFDSSNPSAYMRARRGSIEYQMKFIPSFPREGEDYDPNTTSG
GVYHRRR

Enzyme Prediction     

No EC number prediction in MGYG000001933_00430.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	56	221	1.9e-50	0.9322033898305084

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00056	mtgA	1.09e-113	3	229	5	234	monofunctional biosynthetic peptidoglycan transglycosylase; Provisional
TIGR02070	mono_pep_trsgly	1.60e-85	3	220	4	218	monofunctional biosynthetic peptidoglycan transglycosylase. This family is one of the transglycosylases involved in the late stages of peptidoglycan biosynthesis. Members tend to be small, about 240 amino acids in length, and consist almost entirely of a domain described by pfam00912 for transglycosylases. Species with this protein will have several other transglycosylases as well. All species with this protein are Proteobacteria that produce murein (peptidoglycan). [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	4.16e-68	9	221	20	241	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
pfam00912	Transgly	6.21e-68	56	221	12	177	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
TIGR02074	PBP_1a_fam	7.81e-44	61	220	6	165	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALO48142.1	8.40e-129	6	245	4	242
QNT65514.1	9.78e-128	6	241	6	240
VEH15611.1	9.78e-128	5	243	4	242
QYR10254.1	1.40e-123	3	247	4	247
QUB46829.1	8.45e-122	6	232	4	230

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3NB6_A	1.41e-26	61	201	24	164	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
2OQO_A	1.98e-26	61	201	24	164	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
5U2G_A	1.67e-21	42	205	30	185	2.6Angstrom Resolution Crystal Structure of Penicillin-Binding Protein 1A from Haemophilus influenzae [Haemophilus influenzae Rd KW20],5U2G_B 2.6 Angstrom Resolution Crystal Structure of Penicillin-Binding Protein 1A from Haemophilus influenzae [Haemophilus influenzae Rd KW20]
3DWK_A	1.72e-20	57	222	27	192	ChainA, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_B Chain B, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_C Chain C, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_D Chain D, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL]
4OON_A	2.54e-20	72	221	54	204	Crystalstructure of PBP1a in complex with compound 17 ((4Z,8S,11E,14S)-5-(2-amino-1,3-thiazol-4-yl)-14-(5,6-dihydroxy-1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)-8-formyl-2-methyl-6-oxo-3,10-dioxa-4,7,11-triazatetradeca-4,11-diene-2,12,14-tricarboxylic acid) [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8A8H2	2.45e-92	6	227	7	230	Biosynthetic peptidoglycan transglycosylase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=mtgA PE=3 SV=1
Q3V7G2	7.12e-87	8	227	8	226	Biosynthetic peptidoglycan transglycosylase OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / NCTC 9343 / Onslow) OX=272559 GN=mtgA PE=3 SV=1
Q3V815	7.12e-87	8	227	8	226	Biosynthetic peptidoglycan transglycosylase OS=Bacteroides fragilis (strain YCH46) OX=295405 GN=mtgA PE=3 SV=1
B0RQA5	1.76e-69	11	221	22	235	Biosynthetic peptidoglycan transglycosylase OS=Xanthomonas campestris pv. campestris (strain B100) OX=509169 GN=mtgA PE=3 SV=1
Q8P6V1	1.76e-69	11	221	22	235	Biosynthetic peptidoglycan transglycosylase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) OX=190485 GN=mtgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000010	0.000022	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
9	31