CAZyme Information: MGYG000001925_01748

Basic Information

• Species: Phocaeicola sp900544675
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp900544675
• CAZyme ID: MGYG000001925_01748
• CAZy Family: GH63
• CAZyme Description: Glucosidase YgjK

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
639	MGYG000001925_22|CGC1	72810.52	4.9146

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001925	3441241	MAG	Denmark	Europe

• Gene Location: Start: 11186; End: 13105 Strand: -

Full Sequence      

MKRTILKTWLFSSLIAGLSACTQTTQEPHTDDLRYNFGNILNISLTPDSTVRRAGCFTDA
GSWMGFTLPQTYKWVNGFCGPFSIDNRIWFAQSATTVNFADKTESFSPDSVSYFPGEVYM
KSSSASGSIEQRMNFVNSSTALLQVTTDADCELYFSGKEWNSQVTLKQEEQTITAYHPNG
EIVQLTFMPDITLTCDGKNYTARTQPGCKQTQIALSFYFTDEELNSGTQRSIALLQNPQP
ALDANAERWQGYLQKVLRNDLKQEYDRIAAKAVVTLISNWRTHREGLLHEGVIPSHAVPY
FIGFWAWDSWRFSAALARFAPELAKNNIRAMFDYQQPDGMIIDCIYTNPAENNARDSKPP
LVCWAVDEIFTHNQDTAFVKEMYPQLLAYYKWWYQKRDHNHNGMCEFGATDGTLEAAGWE
SGMDNAIRFDNAKMLQNGPDAWSLDQESVDLNAYLAFECRLLKKFAKLTGNTFDGPDYSE
KVADYFFNDKIGWFCDRRIADGSFIEEPACEGYTPFWVQIASKEQMDKALSLFTDTTKFS
TYIPFPTAAADNPKCDPNGYWRGPIWLDQTYQAIKGLRNYGYKDLADKYTMQVFDRCQGL
TGDAPIHENYGTHNGERLQASHFSWSASHLLMMYEEVNR

Enzyme Prediction     

No EC number prediction in MGYG000001925_01748.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH63	183	636	8e-115	0.5877192982456141

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10137	PRK10137	1.71e-133	1	636	1	782	alpha-glucosidase; Provisional
COG3408	GDB1	9.56e-16	298	634	276	603	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
pfam01204	Trehalase	7.79e-11	357	588	178	450	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
pfam03200	Glyco_hydro_63	1.69e-08	376	635	185	494	Glycosyl hydrolase family 63 C-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the C-terminal catalytic domain.
COG1626	TreA	7.67e-06	417	594	324	506	Neutral trehalase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADY37311.1	0.0	1	639	1	638
QUT89313.1	0.0	14	639	14	642
ALJ59646.1	0.0	14	639	14	642
QQA30340.1	0.0	1	639	1	642
QJR62245.1	0.0	1	639	1	644

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W7S_A	2.68e-73	36	639	4	758	Escherichiacoli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7S_B Escherichia coli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7T_A Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7T_B Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7U_A Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12],3W7U_B Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12]
3W7X_A	1.37e-72	36	639	4	758	Crystalstructure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],3W7X_B Crystal structure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],5CA3_A Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5CA3_B Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
3W7W_A	1.90e-72	36	639	4	758	Crystalstructure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],3W7W_B Crystal structure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],5GW7_A Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5GW7_B Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
3D3I_A	9.41e-70	36	639	5	759	Crystalstructural of Escherichia coli K12 YgjK, a glucosidase belonging to glycoside hydrolase family 63 [Escherichia coli K-12],3D3I_B Crystal structural of Escherichia coli K12 YgjK, a glucosidase belonging to glycoside hydrolase family 63 [Escherichia coli K-12]
7PQQ_B	6.39e-38	36	410	330	769	ChainB, Anti-RON nanobody,Megabody 91,Glucosidase YgjK [Lama glama]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P42592	2.16e-72	36	639	27	781	Glucosidase YgjK OS=Escherichia coli (strain K12) OX=83333 GN=ygjK PE=1 SV=1
D8QTR2	3.02e-16	305	628	98	479	Mannosylglycerate hydrolase MGH1 OS=Selaginella moellendorffii OX=88036 GN=MGH PE=1 SV=1
D8T3S4	7.08e-16	305	628	98	479	Mannosylglycerate hydrolase MGH2 OS=Selaginella moellendorffii OX=88036 GN=SELMODRAFT_447962 PE=3 SV=1
P53008	4.28e-07	376	580	538	762	Mannosyl-oligosaccharide glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CWH41 PE=1 SV=1
Q9W2M2	7.65e-06	417	626	336	566	Trehalase OS=Drosophila melanogaster OX=7227 GN=Treh PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000098	0.999986	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001925_01748.