CAZyme Information: MGYG000001925_01041

Basic Information

• Species: Phocaeicola sp900544675
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp900544675
• CAZyme ID: MGYG000001925_01041
• CAZy Family: GH3
• CAZyme Description: Beta-glucosidase BoGH3A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
740	MGYG000001925_10|CGC2	81674.11	5.7656

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001925	3441241	MAG	Denmark	Europe

• Gene Location: Start: 71086; End: 73308 Strand: +

Full Sequence      

MKKQILTLCAGVAWAVSAAFAQTEGSVPVYLDDSQPIEARVQDALSRMTVEEKVRLSYAQ
GKFSSPGCPRLGIPELWYSDGPHGVRAEINWNDWGYSGWTSDSCTAFPALTCLAATWNLE
LSGKYGKALGEEALYRGKDVQLGPGVNIYRTPLNGRNFEYMGEDPYLAAEMCVPYIQELQ
KNGVAACVKHYALNNQELWRGHIDVEVSDRALYEIYLPAFKAAVQRGGAWSIMGAYNKVR
GTHAAHSKLLNNDILKGEWGFDGCVVTDWGAAHDTYEAAMYGLDLEMGSYTNGLTSEAEF
GYDDYYLGRAYLKLIKEGKIPMEVVNDKAGRVLRLIFRTSMNRKKPFGSMTSPEHYQVSY
EIATEGTVLLKNGNGKKQAGLLPIRQGVYRNILVVGDNATRNLLAGGGSSELKPKDFISP
LEGLSKKFGNVTYAQGYAAGRPMYGQVEEIAQTVMDSLRADAVAKAKEADLVIFVGGLNK
NHQQDCEAGDRISYNLPFQQDELIRSLLEVNKNLVVVLVSGNAVAMPWLDEVPSVVQTWY
LGTITGNALADILSGEVNPSGKLPFSYPVKLEDSPAHAFDALCYPGDSIREVYKEDILVG
YRWYDTKKIEPMFPFGYGLSYTTFEYGKPVISAKTMPKDGTLSVSVKVKNAGPVAGKEIV
QLYIGDEKCSVLRPLKELKGFQKVSLQPGEEKEVTFTITPEALKFFDDKRHEWVAEPGKF
KAYIGASAMDIRGMVSFELL

Enzyme Prediction     

EC	3.2.1.21

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	69	287	2e-64	0.9722222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	3.98e-117	1	740	1	765	beta-glucosidase BglX.
PLN03080	PLN03080	9.18e-70	30	700	42	744	Probable beta-xylosidase; Provisional
COG1472	BglX	9.65e-68	69	432	56	391	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam01915	Glyco_hydro_3_C	5.28e-51	367	621	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
pfam00933	Glyco_hydro_3	4.11e-38	70	335	63	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADY35473.1	0.0	1	740	1	740
ADY36466.1	0.0	1	740	1	740
QRQ54577.1	0.0	1	740	1	741
ALJ47672.1	0.0	1	740	1	741
SCV07070.1	0.0	1	740	6	746

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MS2_A	7.45e-159	41	731	5	660	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	2.35e-126	44	739	8	663	CrystalStructure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	5.60e-122	40	739	3	713	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
2X42_A	8.49e-121	40	739	3	713	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]
4I3G_A	1.45e-104	7	739	28	828	CrystalStructure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae],4I3G_B Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7LXS8	0.0	1	740	6	746	Beta-glucosidase BoGH3A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02644 PE=1 SV=1
P14002	4.08e-158	41	731	5	660	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2
P27034	1.20e-131	41	739	2	810	Beta-glucosidase OS=Rhizobium radiobacter OX=358 GN=cbg-1 PE=3 SV=1
F6C6C1	2.47e-123	48	739	12	672	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium breve (strain ACS-071-V-Sch8b) OX=866777 GN=HMPREF9228_1477 PE=1 SV=1
E7CY69	4.87e-123	48	739	12	672	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium longum OX=216816 GN=apy PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000287	0.999017	0.000167	0.000182	0.000169	0.000157

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001925_01041.