CAZyme Information: MGYG000001922_00202

Basic Information

• Species: CAG-465 sp000433135
• Lineage: Bacteria; Firmicutes_A; Clostridia; TANB77; CAG-465; CAG-465; CAG-465 sp000433135
• CAZyme ID: MGYG000001922_00202
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
603	MGYG000001922_5|CGC1	69768.8	8.6202

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001922	1374088	MAG	Denmark	Europe

• Gene Location: Start: 3817; End: 5628 Strand: -

Full Sequence      

MNFRNLRRGYNYLKANGVKKSLLKLKNKIKRRKYMSNQSVDYLDYVKNNKLSIRTIEKQR
SAKFNYMPKISIVVPMYNTKFSYFVELIDSINNQTYQNFEVCLADSSKIPDVQIQKYIQE
LNSNKIVYKNISQNLGISENTNVAISFSTGDYVAFCDHDDVISINALYEVVKAINSSDAD
FIYTDEDILENGIRKNPHFKPDFSPDLLTSYNYICHLCVVKRKLLDEVGLLNKEFDGAQD
YDFVLRATEKAKNIVHIPKVLYHWRAHETSTSYSSSAKEYVYMAGKRAIEEHFKRINIKA
KVEILDEPGRYRVKYDVIGNPKISVIIPNKDSKSDLKKCIDSILKSSYQNYEIVIVENNS
KTKEIFDYYDKIQKDNDNIKVVSIKIDKFNYSLINNFGVKNSKGEYIVLLNNDTKVLSND
WMEEMLGICQRDDVGIVGAKLLYPDFKVQHAGVVVGIGGVAGHVNVNIAENEEGYFSRAN
VINNFSAVTAACLMIKRSIFEKIDGLDEKLQVAFNDIDLCMKVRKLKYLIVFTPYAKLMH
YESKTRGSEDTPEKIKRFESEMDVFKSKWKDELDRGDPYYNINLRLDKVNFEINTNKMED
KDE

Enzyme Prediction     

No EC number prediction in MGYG000001922_00202.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	71	183	2.4e-22	0.6588235294117647
GT2	324	502	6.2e-20	0.9823529411764705

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04184	GT2_RfbC_Mx_like	1.67e-92	68	266	1	202	Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
cd04186	GT_2_like_c	2.25e-37	325	542	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	1.54e-25	319	548	1	227	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd06433	GT_2_WfgS_like	7.34e-23	71	273	1	202	WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
pfam00535	Glycos_transf_2	7.97e-19	71	225	1	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIB58022.1	1.28e-201	6	597	20	608
QMW77454.1	1.28e-201	6	597	20	608
AEE14040.1	2.20e-201	6	591	373	957
QUO33453.1	3.74e-200	5	596	24	611
QBE99393.1	1.19e-199	6	597	20	608

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3BCV_A	7.01e-08	67	184	4	119	Crystalstructure of a putative glycosyltransferase from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3BCV_B Crystal structure of a putative glycosyltransferase from Bacteroides fragilis [Bacteroides fragilis NCTC 9343]
5HEA_A	8.53e-08	70	180	7	115	CgTstructure in hexamer [Streptococcus parasanguinis FW213],5HEA_B CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEA_C CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEC_A CgT structure in dimer [Streptococcus parasanguinis FW213],5HEC_B CgT structure in dimer [Streptococcus parasanguinis FW213]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55465	4.28e-134	68	595	366	899	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
Q50864	1.03e-85	55	586	306	833	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1
Q58457	9.87e-10	68	282	8	229	Uncharacterized glycosyltransferase MJ1057 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ1057 PE=3 SV=2
P71057	6.09e-07	68	270	4	217	Putative glycosyltransferase EpsH OS=Bacillus subtilis (strain 168) OX=224308 GN=epsH PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000072	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001922_00202.