CAZyme Information: MGYG000001920_01413

Basic Information

• Species: Phocaeicola sp900546355
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp900546355
• CAZyme ID: MGYG000001920_01413
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
383	MGYG000001920_43|CGC1	43273.51	9.3909

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001920	3068459	MAG	Denmark	Europe

• Gene Location: Start: 119; End: 1270 Strand: -

Full Sequence      

MKYYLIVGEASGDLHASNLMRALLAEDPKAEFRFFGGDLMRNVGGTCVRHYKSLAYMGFV
PVLLHLRTILRNMDFCKSDVEAWNPDVLILVDYPGFNLKIAQYIKLHTQIPVFYYISPKI
WAWKEYRIKNIKRDVDGMFSILPFEVEFYRKHQYPIHYVGNPCVDAVAAFRKGYGETFDE
FVLSHGWGKKPIIALLAGSRRQEIKDNLQLMIRASRSFPDYQFVVAGAPGIEPEFYRQYI
DADTEIVFGETYRLLAHATAALVTSGTATLETALFRVPQVVCYYTAAGKLVSLLRRVVLK
VPFVSLVNLIAGKEVVTELVAGDMRVGTIVRGLSLILPGGKERGRMLDDYNRLIQVLGEA
GASERAATQMIEALKAYKKKLYA

Enzyme Prediction     

No EC number prediction in MGYG000001920_01413.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	357	7.8e-107	0.9887005649717514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	6.20e-96	1	375	2	376	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	1.67e-92	1	376	2	381	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	2.02e-70	4	367	2	368	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	2.00e-64	5	372	10	384	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	9.22e-41	1	326	2	306	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADY36062.1	1.86e-249	1	383	1	383
QRO23865.1	3.35e-200	1	374	1	374
QQY38221.1	9.34e-184	1	375	1	378
ABR39591.1	9.34e-184	1	375	1	378
QUT59470.1	1.88e-183	1	375	1	378

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	5.46e-36	5	372	11	379	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	5.46e-36	5	372	11	379	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q2LVL8	6.04e-62	5	375	8	379	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1
Q1D393	1.83e-60	6	374	10	378	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1
Q6ALW0	1.38e-56	6	367	15	379	Lipid-A-disaccharide synthase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) OX=177439 GN=lpxB PE=3 SV=1
Q74AT9	7.70e-55	5	374	11	380	Lipid-A-disaccharide synthase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) OX=243231 GN=lpxB PE=3 SV=1
Q3KH99	3.69e-53	1	371	4	369	Lipid-A-disaccharide synthase OS=Pseudomonas fluorescens (strain Pf0-1) OX=205922 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000074	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001920_01413.