CAZyme Information: MGYG000001920_00817

Basic Information

• Species: Phocaeicola sp900546355
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp900546355
• CAZyme ID: MGYG000001920_00817
• CAZy Family: GH146
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
785	MGYG000001920_19|CGC1	88501.24	6.1451

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001920	3068459	MAG	Denmark	Europe

• Gene Location: Start: 22937; End: 25294 Strand: -

Full Sequence      

MKTWCSAALMTVCVSAAEAHIPVKIETFPMSSVRLTKSPFKHAEDLDIRYLLGIDPDRLL
APYLKGAGLTPKAENYPNWENTGLDGHIGGHYLSALSYMYAATGNAEIKDRLDYMLSEMK
RCQDTSGDGYLCGVPDGRKMWAEIKAGNIRANSFGLNDRWVPLYNIHKTYAGLRDAYLVA
GCKEARDMFVKLTDWMANLTNGLTEEQMQDMLRSEHGGLNEVFADANAITGDTSYLELAH
RFSHKDILNPLLKHEDQLTGKHANTQIPKVIGYKRIADLEGNKAWDDAARFFWETVVTHR
SISIGGNSVREHFHPENDFSSMMTSEQGPETCNTYNMLRLTKMLYQTSGDSRYMDFYERA
LFNHILSTIDPIQGGFVYFTPMRPGHYRVYSQPQTSFWCCVGSGMENHARYGEMIYAHQG
ENELYVNLFIPSVLQWGNVTVEQKTAFPAEEATTVRISATKAKEFAVKFRVPEWTDVSQM
KLTVNGETQEIAASDGYVTVNRKWADGDEVRLTLPMSLHAVKLPDGSANYSFMYGPIVLA
SRMGKQDQIGLFADESRGGHIASGPQYPLQDMPVLVGDTTNVLSHVHKVGNKPMTFKLDG
LYPENYKEMTLEPFNGVHECRYMVYWPMISAEKLKAQQEALTRTEQERATLEAATIDKVT
CGEQQPESDHFIQSEKAVTGTDNDRHWRSTDKNGWFSYQLKTNGRMAGKIRVECVMTQHA
GLTVSVEGKNAVQVSPENADGQQILEFMVPEKMQDKDVLTVKFASGEKDVTPRIYEVRLM
EIDKK

Enzyme Prediction     

EC	3.2.1.185

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH146	33	540	1.1e-213	0.9960238568588469

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	0.0	32	540	1	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	1.68e-126	33	547	12	508	Uncharacterized conserved protein, DUF1680 family [Function unknown].
pfam16375	DUF4986	2.38e-41	544	626	1	84	Domain of unknown function. This family around 150 residues locates in the C-terminal of some uncharacterized proteins in various Bacteroides and Bacillus species. The function of this family remains unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALK86774.1	0.0	1	780	4	781
QJR78256.1	0.0	1	780	4	781
AND18452.1	0.0	1	780	4	781
AII65623.1	0.0	1	780	4	781
AII66677.1	0.0	1	780	4	781

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YQH_AAA	1.12e-282	1	781	1	802	ChainAAA, Acetyl-CoA carboxylase, biotin carboxylase [Bacteroides thetaiotaomicron VPI-5482]
5OPJ_A	3.54e-271	2	781	2	802	Beta-L-arabinofuranosidase[Bacteroides thetaiotaomicron]
4QJY_A	7.58e-21	92	538	82	558	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
6EX6_A	1.63e-19	158	576	130	575	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]
4QK0_A	2.15e-19	92	538	82	558	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.004979	0.993459	0.000846	0.000271	0.000217	0.000199

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001920_00817.