CAZyme Information: MGYG000001913_01766

Basic Information

• Species: UMGS731 sp900544985
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; CAG-272; UMGS731; UMGS731 sp900544985
• CAZyme ID: MGYG000001913_01766
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
400		45118.48	4.5986

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001913	2038964	MAG	Denmark	Europe

• Gene Location: Start: 4146; End: 5348 Strand: +

Full Sequence      

MKKERRSSFTLAAEITALILVFVIIIVAAGADAIKREFDRGEYPRPYKKAVESAAKEFGV
EENLIYAVMKAESKFDAHAVSSAGALGLMQIMPYTYEADIKDKLGIGGEAKLALLDPEIN
IRCGTYYLSRWLLYFDDINTALAAYNAGFGNVRKWLSDTAYSSDGEKIIAENIPFKETRE
YVLRVSYYYEEYNKLYPKDIIPTETTEPKPTDPQITYPGIDYPITWITRGPDERGRIFAN
EFACYAWAEKYCGIYYGDVDPILVMAIIKTESDFVVNAISSSGAYGLMQIMPATYNVDIK
PSIDLTEDFEYLLEDPEFAVKCGTYYLHWLYADSRMLGGSMINVIASYHGGCNAVASWLS
SDELAKDGELIVSKIPIKETGRYVEKVLSNYEYYKNIFGK

Enzyme Prediction     

No EC number prediction in MGYG000001913_01766.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	62	194	2.7e-28	0.8148148148148148
GH23	260	394	7.8e-23	0.8074074074074075

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16896	LT_Slt70-like	4.05e-59	44	190	1	145	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	1.13e-52	43	195	2	152	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd16896	LT_Slt70-like	3.71e-39	249	392	9	145	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd00254	LT-like	3.23e-37	62	190	1	111	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd16893	LT_MltC_MltE	1.02e-32	50	190	2	162	membrane-bound lytic murein transglycosylases MltC and MltE, and similar proteins. MltC and MltE are periplasmic, outer membrane attached lytic transglycosylases (LTs), which cleave beta-1,4-glycosidic bonds joining N-acetylmuramic acid and N-acetylglucosamine in the cell wall peptidoglycan, yielding 1,6-anhydromuropeptides. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACL76418.1	4.48e-38	1	196	4	191
QJA07934.1	8.72e-36	43	199	31	180
QPK99408.1	9.95e-36	43	198	31	180
AVD40846.1	9.95e-36	43	198	31	180
QQY50391.1	9.95e-36	43	198	31	180

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6FBT_A	1.42e-18	43	188	445	588	ChainA, Lytic murein transglycosylase [Pseudomonas aeruginosa]
5OHU_A	1.48e-18	43	188	474	617	TheX-ray Structure of Lytic Transglycosylase Slt from Pseudomonas aeruginosa [Pseudomonas aeruginosa]
6FCQ_A	3.41e-18	43	188	445	588	ChainA, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCR_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCS_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCU_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa]
6FC4_A	3.41e-18	43	188	446	589	ChainA, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa]
1SLY_A	1.50e-14	60	188	466	594	ComplexOf The 70-Kda Soluble Lytic Transglycosylase With Bulgecin A [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31608	4.68e-19	50	189	63	179	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
Q9CLB8	1.15e-14	47	185	190	347	Membrane-bound lytic murein transglycosylase C OS=Pasteurella multocida (strain Pm70) OX=272843 GN=mltC PE=3 SV=2
Q7VKB7	1.23e-14	45	186	197	357	Membrane-bound lytic murein transglycosylase C OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) OX=233412 GN=mltC PE=3 SV=1
Q4QMD8	1.53e-14	45	185	187	346	Membrane-bound lytic murein transglycosylase C OS=Haemophilus influenzae (strain 86-028NP) OX=281310 GN=mltC PE=3 SV=1
P44049	1.53e-14	45	185	187	346	Membrane-bound lytic murein transglycosylase C OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=mltC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.581356	0.306040	0.002968	0.001416	0.000981	0.107235

TMHMM  Annotations     

start	end
7	29