CAZyme Information: MGYG000001913_00099

Basic Information

• Species: UMGS731 sp900544985
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; CAG-272; UMGS731; UMGS731 sp900544985
• CAZyme ID: MGYG000001913_00099
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
660	MGYG000001913_1|CGC2	75940.9	4.8008

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001913	2038964	MAG	Denmark	Europe

• Gene Location: Start: 114251; End: 116233 Strand: +

Full Sequence      

MSKSKWIWNPDAFERYHGMLVHNRRTVSGIYCPPMWRIDSPSGNLFLYKVAVLEKPETVT
MYANTECATILVAGKRYHAGEKVTVPEGRQMIKVNAFKESGFPAIYVEGDTFASDETWLH
GSYGGKDVRAGTNDMYTDISDNPEIFKFSYKRIFPLNVEEINGGKLYDFGKESFGKLVFE
NMTSDSDDFTVYCGESKEEALDEDFAVVRVHISAKKEKYVSESVAFRYVFIPMCNAKFDF
SADFEYLPIEDKGNFVCDDEEINKIYSTSSYTLHLNAREGFFDGIKRDRWVWGGDAYQSF
LADYYLMLDCDIVKRTLNILHGAEPMTMHVNTIPDYTFYWVMSLWEYYLYTGDKALVSSF
YDKLLSTMNFAESKLCDGLYTRCRGDWVFVDWADFDKDSGPMCAEQMLLCAAYKCASYCA
ELVEDGEKADFYKKRYSEVREKINTLYWDDEKSAFIDDYATGNRNVTRHANIFAILYDLT
SEERKGLIKENVIKNPEIAAITTPYFRFFELAAMAEIGEFSYVEEVLRSYWGGMLKLGAT
TFWEEYDSRENGREHYAMYGKPYDRSLCHAWGGSSPIYLLGRYILGVKPTSPNYETYTVT
PCLETNFGNIKGKVPTLRGDIYVDIEKDNVSVYSEIPGGKLIFKDKTYDIEKGKKITISL

Enzyme Prediction     

EC	3.2.1.40

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	163	638	6.9e-99	0.9702380952380952

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	1.16e-27	250	584	1	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
COG3408	GDB1	5.71e-07	73	488	97	502	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
pfam17390	Bac_rhamnosid_C	4.39e-04	586	637	1	54	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
TIGR01577	oligosac_amyl	0.002	340	455	360	465	oligosaccharide amylase. The name of this type of amylase is based on the characterization of an glucoamylase family enzyme from Thermoactinomyces vulgaris. The T. vulgaris enzyme was expressed in E. coli and, like other glucoamylases, it releases beta-D-glucose from starch. However, unlike previously characterized glucoamylases, this T. vulgaris amylase hydrolyzes maltooligosaccharides (maltotetraose, maltose) more efficiently than starch (1), indicating this enzyme belongs to a class of glucoamylase-type enzymes with oligosaccharide-metabolizing activity.
pfam01204	Trehalase	0.009	408	488	310	392	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKS45153.1	2.77e-179	2	652	5	650
QHV99947.1	3.39e-178	2	658	22	698
QYR22424.1	7.30e-178	1	660	1	656
QIP13638.1	8.63e-176	2	658	22	698
QNL52267.1	2.68e-171	3	647	31	695

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CIH_A	7.58e-150	6	646	20	697	Crystalstructure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
2OKX_A	4.78e-39	248	601	532	893	Crystalstructure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1],2OKX_B Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1]
4XHC_A	3.80e-26	259	583	213	541	ChainA, Alpha-L-rhamnosidase [Klebsiella oxytoca],4XHC_B Chain B, Alpha-L-rhamnosidase [Klebsiella oxytoca]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P9WF03	1.37e-11	242	637	459	869	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000039	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001913_00099.